 №. Ilyasov R.A.,
Аннотация |
290. Бюхлер Р., Узунов А., Ильясов Р. А., Коста С., Мейкснер М., Ле Конте И., Мондет Ф., Ковачич М., Андонов С., Каррек Н. Л., Димитров Л., Бассо, Б., Биенковска М., Далл’Олио Р., Хатджина Ф., Вирц У. Проект EURBEST: тестирование пчел на устойчивость к клещу варроа // Пчеловодство. ‒ 2022. № 2. ‒ C. 62-64. (Büchler R., Uzunov A., Ilyasov R. A., Costa C., Meixner M., Le Conte Y., Mondet F., Kovacic M., Andonov S., Carreck N. L., Dimitrov L., Basso B., Bienkowska M., Dall’Olio R., Hatjina F., Wirtz U. EURBEST project: testing bees for resistance to the mite Varroa // Russian Journal of Beekeeping "Pchelovodstvo". ‒ 2022. № 2. ‒ P. 62-64.)
Бюхлер Р., Узунов А., Ильясов Р. А., Коста С., Мейкснер М., Ле Конте И., Мондет Ф., Ковачич М., Андонов С., Каррек Н. Л., Димитров Л., Бассо, Б., Биенковска М., Далл’Олио Р., Хатджина Ф., Вирц У. Проект EURBEST: тестирование пчел на устойчивость к клещу варроа // Пчеловодство. ‒ 2022. № 2. ‒ C. 62-64. (Büchler R., Uzunov A., Ilyasov R. A., Costa C., Meixner M., Le Conte Y., Mondet F., Kovacic M., Andonov S., Carreck N. L., Dimitrov L., Basso B., Bienkowska M., Dall’Olio R., Hatjina F., Wirtz U. EURBEST project: testing bees for resistance to the mite Varroa // Russian Journal of Beekeeping "Pchelovodstvo". ‒ 2022. № 2. ‒ P. 62-64.)
В 2017 году Европейская комиссия создала международный консорциум по исследованию пчел EurBeST (European Bee Selection Team) на базе Института пчеловодства в Кирхгайне, Германия. В рамках основной части проекта EurBeST было проведено пять крупномасштабных исследований, включающих семь стран Европейского Союза и 130 пчеловодов. Команда EurBeST определила и отобрала 23 линии пчел, принадлежащие к шести подвидам пчел, а также пчел гибридного происхождения. Пчелы были тестированы на общие признаки и признаки устойчивости к клещу Varroa. Тестирование пчел было проведено на двух различных уровнях: [1] сравнительное тестирование исследователями нескольких тестовых линий пчел на одной пасеке, [2] сравнительное тестирование коммерческими пчеловодами нескольких тестовых линий пчел вместе со своими линиями пчел в обычных полевых условиях. Проект EurBeST испытал более 3500 семей в течение одного сезона и считается одним из крупнейших исследований по оценке медоносных пчел на устойчивость к клещу Varroa в Европе. В результате проведенных исследований EurBeST были получены сведения о линиях медоносных пчел, обладающих устойчивостью к клещу Varroa и способные подавлять размножение клещей Varroa в семье. Селекции пчел является важным и единственно возможным инструментом для перехода к экологически чистому пчеловодству без лечения от болезней. Было доказано, что селекция пчел на устойчивость к клещу Varroa работает, но она дорогостоящая. Гигиеническое поведение против клеща Varroa и подавление его развития являются полезным критериями для отбора пчел, устойчивых к клещу Varroa. Однако затраты на тестирование пчел для селекционеров высоки и должны быть компенсированы государством.
In 2017, the European Commission set up the international bee research consortium EurBeST (European Bee Selection Team) based at the Institute of Beekeeping in Kirchhain, Germany. Five large-scale surveys involving seven European Union countries and 130 beekeepers have been carried out in the core part of the EurBeST project. The EurBeST team identified and selected 23 honey bee lines belonging to six bee subspecies as well as bees of hybrid origin. They were tested for common traits and traits of resistance to the Varroa mite. Honey bee testing has been performed at two different levels: [1] comparative testing by researchers of several test honey bee lines in a single apiary; and [2] comparative testing by commercial beekeepers of several test honey bee lines together with their honey bee lines under normal field conditions. The EurBeST project has evaluated more than 3500 colonies in a single season and is considered one of the biggest studies in Europe for the evaluation of the resistance of honey bees to the Varroa mite. The results of the EurBeST surveys have shown that Varroa mite-resistant honey bee lines can suppress Varroa mite reproduction in honey bee colonies. Honey bee selection is an important and the only possible tool for the transition to environmentally friendly beekeeping without disease treatment. The selection of bees for resistance to the Varroa mite has been proven to work, but it is expensive. Hygienic behavior of honey bees against the Varroa mite and suppression of its development are useful criteria for selecting Varroa mite-resistant honey bees. However, the cost of testing bees for breeders is high and must be compensated by the government. |
289. Ильясов, Р.А., Такахаши, Д.И., Ли, М.Л., Прощалыкин, М.Ю., Лелей, А.С., Квон, Х.В., Даниленко, В.Н., Николенко, А.Г., 2022. Характеристика клещей Varroa underwoodi (Acari Varroidae) в популяции Apis cerana ussuriensis (Hymenoptera: Apidae) в Приморском крае, Россия. Журнал Общей Биологии. 83 (1), 38-50. doi: 10.31857/S0044459622010055. (SCI, WoS, Scopus). IF = 1,028.
Ilyasov, R.A., Takahashi, J.I., Lee, M.L., Proshchalykin, M.Y., Lelej, A.S., Kwon, H.W., Danilenko, V.N., Nikolenko, A.G., 2022. Characteristics of Varroa underwoodi mites (Acari: Varroidae) in the population of Apis cerana ussuriensis (Hymenoptera: Apidae) in the Primorsky Krai of Russia. Biology Bulletin Reviews (Zhurnal obshchei biologii). 83 (1), 38-50. doi: 10.31857/S0044459622010055. (SCI, WoS, Scopus). IF = 1,028. ISSN 0044-4596
Ильясов, Р.А., Такахаши, Д.И., Ли, М.Л., Прощалыкин, М.Ю., Лелей, А.С., Квон, Х.В., Даниленко, В.Н., Николенко, А.Г., 2022. Характеристика клещей Varroa underwoodi (Acari Varroidae) в популяции Apis cerana ussuriensis (Hymenoptera: Apidae) в Приморском крае, Россия. Журнал Общей Биологии. 83 (1), 38-50. doi: 10.31857/S0044459622010055. (SCI, WoS, Scopus). IF = 1,028.
Ilyasov, R.A., Takahashi, J.I., Lee, M.L., Proshchalykin, M.Y., Lelej, A.S., Kwon, H.W., Danilenko, V.N., Nikolenko, A.G., 2022. Characteristics of Varroa underwoodi mites (Acari: Varroidae) in the population of Apis cerana ussuriensis (Hymenoptera: Apidae) in the Primorsky Krai of Russia. Biology Bulletin Reviews (Zhurnal obshchei biologii). 83 (1), 38-50. doi: 10.31857/S0044459622010055. (SCI, WoS, Scopus). IF = 1,028. ISSN 0044-4596
Abstract. Species of the genus Varroa are ectoparasitic mites of the Apis honey bees. Unlike the well-known species ofmites V. destructor and V. jacobsoni, V. underwoodi is still poorly studied. According to foreign publications, thecurrently recognized distribution of V. underwoodi in the A. cerana population includes Nepal, South Korea,Japan, Malaysia, India, Indonesia, Papua New Guinea, Vietnam, and China. Recently it was discovered inthe Russia (Primorsky Krai) on the honey bees A. cerana ussuriensis. Since V. destructor and V. jacobsoni havethe ability to easily switch to other bee species, there is a possibility that later V. underwoodi may also extensively switch from Asian honey bees A. cerana to European honey bees A. mellifera. The first case of V. underwoodi parasitizing in A. mellifera colonies was recorded in Papua New Guinea. The parasitic mite V. underwoodi requires careful study, since it is a new potential parasite of honey bees A. mellifera, which can also bringnew species and strains of viruses and bacteria, change the composition of the gut microbiome, and disruptthe protective and adaptive mechanisms of the bees. The article presents the data on morphometry and polymorphism of the gene COX1 of mtDNA. Varroa underwoodi was compared with other mite species V. destructor and V. jacobsoni. The mean genetic divergence and p-distance between V. underwoodi and other Varroaspecies were 9% and 0.09, respectively, which are consistent with the level of species differences in insects.The nucleotide sequences of the gene COX1 of mtDNA of V. underwoodi from Primorsky Krai of RussiaLC532104 and from the Jilin province of China MH205176 turned out to be identical and were assigned tothe China 1 MH205176 haplotype. It is assumed that there is continuous migration between the A. ceranapopulations of Russia and China, which led to the spread of V. underwoodi in the natural population of A. cerana ussuriensis in the Primorsky Krai of Russia, and the mite is currently distributed up to 45.06°N. Thus, thenorthern border of the V. underwoodi range is located on the territory of Russian Far East and, probably, coincides with the range of A. cerana ussuriensis. It is likely that the selection of A. mellifera bee colonies for hygienic behavior against the V. destructor mite may also be effective against V. underwoodi and will prevent thepossible transition of V. underwoodi from Asian A. cerana to European A. mellifera.
Аннотация. Виды рода Varroa являются эктопаразитическими клещами медоносных пчел рода Apis. В отличие от хорошо известных видов клещей V. destructor и V. jacobsoni, V. underwoodi остается мало изученным. Современный ареал V. underwoodi в популяции A. cerana включает Непал, Южную Корею, Японию, Малайзию, Индию, Индонезию, Папуа-Новую Гвинею, Вьетнам и Китай. Недавно он был найден в России (Приморский край) на A. cerana ussuriensis. Поскольку V. destructor и V. jacobsoni обладают способностью легко переходить на другие виды медоносных пчел, есть большая вероятность того,что V. underwoodi может в дальнейшем перейти в массовом порядке с A. cerana на A. mellifera. Первый случай паразитирования V. underwoodi в семьях пчел A. mellifera зафиксирован в Папуа-Новой Гвинее. Varroa underwoodi требует тщательного изучения, поскольку является новым потенциальным паразитом A. mellifera и способен принести с собой новые виды и штаммы вирусов и бактерий, изменить состав микробиома кишечника пчел, нарушить защитные и адаптивные механизмы их организма. В статье представлены данные морфометрии V. underwoodi и полиморфизма его гена COX1мтДНК. Проведено сравнение V. underwoodi с другими видами клещей V. destructor и V. jacobsoni. Средняя генетическая дивергенция и p-дистанция между V. underwoodi и другими видами Varroa составляли 9% и 0.09 соответственно, что согласуется со средним уровнем видовых различий у насекомых. Нуклеотидные последовательности гена COX1 мтДНК V. underwoodi из Приморского края (Россия) LC532104 и провинции Цзилинь (Китай) MH205176 оказались идентичными и отнесены кгаплотипу China 1 MH205176. Предполагается, что между популяциями A. cerana России и Китая происходит непрерывный обмен, который привел к появлению V. underwoodi в природной популяции A. cerana ussuriensis в Приморском крае. Современная северная граница ареала V. underwoodi проходит по территории Дальнего Востока России и, вероятно, совпадает с таковой A. cerana ussuriensis (45.06° с.ш.). Вероятно, селекция семей пчел A. mellifera по гигиеническому поведению против клещей V. destructor может оказаться эффективной также против V. underwoodi и позволит предотвратить возможный переход V. underwoodi с азиатских пчел A. cerana на европейских пчел A. mellifera. |
288. Ильясов, Р.А., Макмаллан, Д., 2022. Формирование естественной устойчивости к клещу Varroa destructor в популяции темной лесной пчелы в Ирландии. Пчеловодство (1), 60-62.
Ilyasov, R.A., Mcmullan, J., 2022. Formation of natural resistance to the Varroa destructor mite in the population of the dark forest bee in Ireland. Russian Journal of Beekeeping "Pchelovodstvo" (1), 60-62.
Ильясов, Р.А., Макмаллан, Д., 2022. Формирование естественной устойчивости к клещу Varroa destructor в популяции темной лесной пчелы в Ирландии. Пчеловодство (1), 60-62.
Ilyasov, R.A., Mcmullan, J., 2022. Formation of natural resistance to the Varroa destructor mite in the population of the dark forest bee in Ireland. Russian Journal of Beekeeping "Pchelovodstvo" (1), 60-62.
Аннотация. В Ирландию клещ Varroa destructor впервые был завезен в 1998 году, который в течение последующих 5 лет стал паразитировать во всей популяции местных пчел Apis mellifera mellifera. В 2010 году в ходе естественного отбора в популяции пчел A. m. mellifera в Ирландии сформировалась устойчивость к клещу V. destructor. Было проведено исследование особенностей формирования в местной популяции пчел A. m. mellifera в Ирландии естественной устойчивости к клещу V. destructor. Было показано, что местные ирландские пчелы A. m. mellifera выработали способ борьбы с паразитическим клещом Varroa путем физического повреждения их тела – идиосомы и конечностей. Было показано, что упавшие на дно улья поврежденные клещи были практически неподвижными и не могли вернуться в гнездовой корпус. Было показано, что температура внутри улья имеет критическое значение для развития пчелиной семьи и паразитирования клеща Varroa. При использовании сетчатых полов в ульях в весенний период температура в улье будет падать, что будет замедлять развитие расплода пчел и давать репродуктивное преимущество для клещей Varroa.
Abstract. The Varroa destructor mite was first introduced to Ireland in 1998 and, over the next 5 years, began to parasitize the entire population of local Apis mellifera mellifera bees. Since 2010, in result of natural selection, the resistance to the V. destructor mite has developed in the population of A. m. mellifera in Ireland. The study of the natural formation of resistance to the V. destructor mite in the population of A. m. mellifera in Ireland was performed. The native Irish bees A. m. mellifera have developed a way to fight the parasitic mite Varroa by physically damaging its bodies - idiosomes and limbs. It was shown that the damaged mites that fell to the bottom of the hive were practically immobile and could not return to the nesting housing. It has been shown that the temperature inside the hive is critical for the development of the bee colony and the parasitism of the Varroa mite. Using the mesh floors in hives during the spring able to drop the temperature in the hive, which will slow down the development of brood bees and will give a reproductive advantage to Varroa mites. |
287. Ильясов Р. А., Хан Г. Ю., Ли М. Л., Ким К. В., Парк Д. Х., Такахаши Д. И., Квон Х. В., Николенко А. Г. Клещ Varroa underwoodi - потенциальный паразит европейских пчел. Часть 2 // Пчеловодство. - 2021. № 10. - C. 24-27. (Ilyasov R. A., Han G. Y., Lee M. L., Kim K. W., Park J. H., Takahashi J. I., Kwon H. W., Nikolenko A. G. Ìite Varroa underwoodi - a potential parasite of Apis mellifera. Part 2 // Russian Journal of Beekeeping "Pchelovodstvo". - 2021. 10. - P. 24-27.)
Ильясов Р. А., Хан Г. Ю., Ли М. Л., Ким К. В., Парк Д. Х., Такахаши Д. И., Квон Х. В., Николенко А. Г. Клещ Varroa underwoodi - потенциальный паразит европейских пчел. Часть 2 // Пчеловодство. - 2021. № 10. - C. 24-27. (Ilyasov R. A., Han G. Y., Lee M. L., Kim K. W., Park J. H., Takahashi J. I., Kwon H. W., Nikolenko A. G. Ìite Varroa underwoodi - a potential parasite of Apis mellifera. Part 2 // Russian Journal of Beekeeping "Pchelovodstvo". - 2021. 10. - P. 24-27.)
Аннотация. Виды рода Varroa являются эктопаразитическими клещами медоносных пчел рода Apis. В отличие от хорошо известных видов клещей V. destructor и V. jacobsoni, V. underwoodi до сих пор остается малоизученным. Согласно зарубежным публикациям, признанный ареал распространения V. underwoodi в популяции A. cerana включает Непал, Южную Корею, Японию, Малайзию, Индию, Индонезию, Папуа-Новую Гвинею, Вьетнам и Китай, за исключением России. Хотя V. underwoodi ранее описывался на пчелах подвида A. c. ussuriensis в Приморском крае России, этот факт до сих пор остается малоизвестным в связи с небольшим количеством публикаций на английском языке. Поскольку V. destructor и V. jacobsoni обладают способностью легко переходить на другие виды пчел, есть вероятность того, что V. underwoodi также может в дальнейшем перейти с азиатских пчел A. cerana на европейских пчел A. mellifera. Первый случай паразитирования V. underwoodi в семьях пчел A. mellifera был зафиксирован в Папуа-Новой Гвинее. Паразитический клещ V. underwoodi требует тщательного изучения, поскольку является новым потенциальным паразитом A. mellifera, который способен также принести с собой новые виды и штаммы вирусов и бактерий, изменить состав микробиома кишечника, нарушить защитные и адаптивные механизмы организма. В статье представлены данные морфометрии и полиморфизма гена COX1 мтДНК. Было проведено сравнение V. underwoodi с другими видами клещей V. destructor и V. jacobsoni. Средняя генетическая дивергенция и p-дистанция между V. underwoodi и другими видами Varroa составляли 9% и 0,09, соответственно, которые согласуются с уровнем видовых различий у членистоногих. Нуклеотидные последовательности гена COX1 мтДНК V. underwoodi из Приморского края России LC532104 и из провинции Jilin Китая MH205176 оказались идентичными и были отнесены к гаплотипу China 1 MH205176. Предполагается, что между популяциями A. cerana России и Китая происходит непрерывная миграция, которая привела к распространению клеща V. underwoodi в природной популяции A. c. ussuriensis в Приморском крае России. Таким образом, северная граница ареала V. underwoodi находится на территории России и, вероятно, совпадает с ареалом A. c. ussuriensis и доходит до 45.060 с. ш. Вероятно, что селекции семей пчел A. mellifera по гигиеническому поведению против клеща V. destructor может оказаться эффективной также против V. underwoodi и позволит предотвратить возможный переход V. underwoodi с азиатских пчел A. cerana на европейских пчел A. mellifera.
Abstract. Species of the genus Varroa are ectoparasitic mites of the Apis honeybees. Unlike the well-known species of ticks V. destructor and V. jacobsoni, V. underwoodi is still poorly studied. According to foreign publications, the recognized distribution area of V. underwoodi in the A. cerana population includes Nepal, South Korea, Japan, Malaysia, India, Indonesia, Papua New Guinea, Vietnam, and China, with the exception of Russia. Although V. underwoodi was previously described on honey bees of the subspecies A. c. ussuriensis in the Primorsky Territory of Russia, this fact is still little known due to the small number of publications in English. Since V. destructor and V. jacobsoni have the ability to easily switch to other bee species, there is a possibility that V. underwoodi may also later switch from Asian honey bees A. cerana to European honey bees A. mellifera. The first case of V. underwoodi parasitizing in A. mellifera colonies was recorded in Papua New Guinea. The parasitic mite V. underwoodi requires careful study, since it is a new potential parasite of honey bees A. mellifera, which can also bring with it new species and strains of viruses and bacteria, change the composition of the gut microbiome, and disrupt the protective and adaptive mechanisms of the organism. The article presents the data of morphometry and polymorphism of the gene COX1 of mtDNA. V. underwoodi was compared with other mite species V. destructor and V. jacobsoni. The mean genetic divergence and p-distance between V. underwoodi and other Varroa species were 9% and 0.09, respectively, which are consistent with the level of species differences in arthropods. The nucleotide sequences of the gene COX1 of mtDNA of V. underwoodi from Primorsky Territory of Russia LC532104 and from the Jilin province of China MH205176 turned out to be identical and were assigned to the China 1 MH205176 haplotype. It is assumed that there is continuous migration between the A. cerana populations of Russia and China, which led to the spread of the V. underwoodi tick in the natural population of A. c. ussuriensis in the Primorsky Territory of Russia and is distributed up to 45.06N. Thus, the northern border of the V. underwoodi range is located on the territory of Russia and, probably, coincides with the range of A. c. ussuriensis. It is likely that the selection of A. mellifera bee colonies for hygienic behavior against the V. destructor mite may also be effective against V. underwoodi and will prevent the possible transition of V. underwoodi from the Asian A. cerana bees to the European A. mellifera bees. |
286. Ильясов Р. А., Хан Г. Ю., Ли М. Л., Ким К. В., Парк Д. Х., Такахаши Д. И., Квон Х. В., Николенко А. Г. Клещ Varroa underwoodi - потенциальный паразит европейских пчел. Часть 1 // Пчеловодство. - 2021. № 9. - C. 28-32. (Ilyasov R. A., Han G. Y., Lee M. L., Kim K. W., Park J. H., Takahashi J. I., Kwon H. W., Nikolenko A. G. Ìite Varroa underwoodi - a potential parasite of Apis mellifera. Part 1 // Russian Journal of Beekeeping "Pchelovodstvo". - 2021. 9. - P. 28-32.)
Ильясов Р. А., Хан Г. Ю., Ли М. Л., Ким К. В., Парк Д. Х., Такахаши Д. И., Квон Х. В., Николенко А. Г. Клещ Varroa underwoodi - потенциальный паразит европейских пчел. Часть 1 // Пчеловодство. - 2021. № 9. - C. 28-32. (Ilyasov R. A., Han G. Y., Lee M. L., Kim K. W., Park J. H., Takahashi J. I., Kwon H. W., Nikolenko A. G. Ìite Varroa underwoodi - a potential parasite of Apis mellifera. Part 1 // Russian Journal of Beekeeping "Pchelovodstvo". - 2021. 9. - P. 28-32.)
Аннотация. Виды рода Varroa являются эктопаразитическими клещами медоносных пчел рода Apis. В отличие от хорошо известных видов клещей V. destructor и V. jacobsoni, V. underwoodi до сих пор остается малоизученным. Согласно зарубежным публикациям, признанный ареал распространения V. underwoodi в популяции A. cerana включает Непал, Южную Корею, Японию, Малайзию, Индию, Индонезию, Папуа-Новую Гвинею, Вьетнам и Китай, за исключением России. Хотя V. underwoodi ранее описывался на пчелах подвида A. c. ussuriensis в Приморском крае России, этот факт до сих пор остается малоизвестным в связи с небольшим количеством публикаций на английском языке. Поскольку V. destructor и V. jacobsoni обладают способностью легко переходить на другие виды пчел, есть вероятность того, что V. underwoodi также может в дальнейшем перейти с азиатских пчел A. cerana на европейских пчел A. mellifera. Первый случай паразитирования V. underwoodi в семьях пчел A. mellifera был зафиксирован в Папуа-Новой Гвинее. Паразитический клещ V. underwoodi требует тщательного изучения, поскольку является новым потенциальным паразитом A. mellifera, который способен также принести с собой новые виды и штаммы вирусов и бактерий, изменить состав микробиома кишечника, нарушить защитные и адаптивные механизмы организма. В статье представлены данные морфометрии и полиморфизма гена COX1 мтДНК. Было проведено сравнение V. underwoodi с другими видами клещей V. destructor и V. jacobsoni. Средняя генетическая дивергенция и p-дистанция между V. underwoodi и другими видами Varroa составляли 9% и 0,09, соответственно, которые согласуются с уровнем видовых различий у членистоногих. Нуклеотидные последовательности гена COX1 мтДНК V. underwoodi из Приморского края России LC532104 и из провинции Jilin Китая MH205176 оказались идентичными и были отнесены к гаплотипу China 1 MH205176. Предполагается, что между популяциями A. cerana России и Китая происходит непрерывная миграция, которая привела к распространению клеща V. underwoodi в природной популяции A. c. ussuriensis в Приморском крае России. Таким образом, северная граница ареала V. underwoodi находится на территории России и, вероятно, совпадает с ареалом A. c. ussuriensis и доходит до 45.060 с. ш. Вероятно, что селекции семей пчел A. mellifera по гигиеническому поведению против клеща V. destructor может оказаться эффективной также против V. underwoodi и позволит предотвратить возможный переход V. underwoodi с азиатских пчел A. cerana на европейских пчел A. mellifera.
Abstract. Species of the genus Varroa are ectoparasitic mites of the Apis honeybees. Unlike the well-known species of ticks V. destructor and V. jacobsoni, V. underwoodi is still poorly studied. According to foreign publications, the recognized distribution area of V. underwoodi in the A. cerana population includes Nepal, South Korea, Japan, Malaysia, India, Indonesia, Papua New Guinea, Vietnam, and China, with the exception of Russia. Although V. underwoodi was previously described on honey bees of the subspecies A. c. ussuriensis in the Primorsky Territory of Russia, this fact is still little known due to the small number of publications in English. Since V. destructor and V. jacobsoni have the ability to easily switch to other bee species, there is a possibility that V. underwoodi may also later switch from Asian honey bees A. cerana to European honey bees A. mellifera. The first case of V. underwoodi parasitizing in A. mellifera colonies was recorded in Papua New Guinea. The parasitic mite V. underwoodi requires careful study, since it is a new potential parasite of honey bees A. mellifera, which can also bring with it new species and strains of viruses and bacteria, change the composition of the gut microbiome, and disrupt the protective and adaptive mechanisms of the organism. The article presents the data of morphometry and polymorphism of the gene COX1 of mtDNA. V. underwoodi was compared with other mite species V. destructor and V. jacobsoni. The mean genetic divergence and p-distance between V. underwoodi and other Varroa species were 9% and 0.09, respectively, which are consistent with the level of species differences in arthropods. The nucleotide sequences of the gene COX1 of mtDNA of V. underwoodi from Primorsky Territory of Russia LC532104 and from the Jilin province of China MH205176 turned out to be identical and were assigned to the China 1 MH205176 haplotype. It is assumed that there is continuous migration between the A. cerana populations of Russia and China, which led to the spread of the V. underwoodi tick in the natural population of A. c. ussuriensis in the Primorsky Territory of Russia and is distributed up to 45.06N. Thus, the northern border of the V. underwoodi range is located on the territory of Russia and, probably, coincides with the range of A. c. ussuriensis. It is likely that the selection of A. mellifera bee colonies for hygienic behavior against the V. destructor mite may also be effective against V. underwoodi and will prevent the possible transition of V. underwoodi from the Asian A. cerana bees to the European A. mellifera bees. |
285. Danilenko, V.N., Devyatkin, A.V., Marsova, M.V., Shibilova, M.U., Ilyasov, R.A., Shmyrev, V.I., 2021. Common inflammatory mechanisms in COVID-19 and Parkinson’s diseases: the role of microbiome, pharmabiotics and postbiotics in their prevention. Journal of Inflammation Research 14, 6349–6381. doi: 10.2147/JIR.S333887.
Danilenko, V.N., Devyatkin, A.V., Marsova, M.V., Shibilova, M.U., Ilyasov, R.A., Shmyrev, V.I., 2021. Common inflammatory mechanisms in COVID-19 and Parkinson’s diseases: the role of microbiome, pharmabiotics and postbiotics in their prevention. Journal of Inflammation Research 14, 6349–6381. doi: 10.2147/JIR.S333887.
Abstract. In the last decade, metagenomic studies have shown the key role of the gut microbiome in maintaining immune and neuroendocrine systems. Malfunction of the gut microbiome can induce inflammatory processes, oxidative stress, and cytokine storm. Dysfunction of the gut microbiome can be caused by short-term (virus infection and other infectious diseases) or long-term (environment, nutrition, and stress) factors. Here we reviewed the inflammation and oxidative stress in neurodegenerative diseases and coronavirus infection (COVID-19). Here we reviewed the renin-angiotensin-aldosterone system (RAAS) involved in the processes of formation of oxidative stress and inflammation in viral and neurodegenerative diseases. Moreover, the coronavirus uses ACE2 receptors of the RAAS to penetrate human cells. The coronavirus infection can be the trigger for neurodegenerative diseases by dysfunction of the RAAS. Pharmabiotics, or next-generation probiotics, are considered as a means to prevent oxidative stress, inflammatory processes, neurodegenerative and viral diseases through gut microbiome regulation.
|
284. Ilyasov, R., 2021. Burzyan population of the dark forest honey bee Apis mellifera mellifera. European Journal of Zoological Research 9 (6), 49-50. https://www.scholarsresearchlibrary.com/abstract/burzyan-population-of-the-dark-forest-honey-bee-apis-mellifera-mellifera-82175.html
Ilyasov, R., 2021. Burzyan population of the dark forest honey bee Apis mellifera mellifera. European Journal of Zoological Research 9 (6), 49-50. https://www.scholarsresearchlibrary.com/abstract/burzyan-population-of-the-dark-forest-honey-bee-apis-mellifera-mellifera-82175.html.
Abstract. The European honey bee Apis mellifera is important for humans and the environment as a pollinator for agricultural and wild plants [1]. The number of honey bee colonies has declined annually in recent decades [2, 3] due to a variety of factors, including climate change, habitat loss, pesticide use, the spread of pests and pathogens, and hybridization with introduced southern subspecies, such as Apis mellifera ligustica, Apis mellifera caucasia, and Apis mellifera carpathica [4, 5, 6]. Due to its extensive distribution area in a wide range of climatic and ecological zones, A. mellifera is currently subdivided into 30 subspecies, as well as dozens of ecotypes [7, 8, 9]. The gene pool of bee populations plays an important role in adaptation, therefore maintaining the gene pool is a prerequisite for maintaining efficient and sustainable beekeeping [9].
The honey bee subspecies Apis mellifera mellifera has the most northern distribution and is adapted to living in a sharply continental climate and is of value for the countries of Northern and Western Europe and Russia [9, 10, 11]. Recently, among other local populations of honey bees, the Burzyan population of the dark forest bee is considered the most preserved and isolated due to its location in the remote mountain-forest zone of the Southern Urals. The popularity of the Burzyan population of the dark forest bee is provided by the following factors. Firstly, colonies of honey bees of the Burzyan population live not only in semi-domestic conditions in artificial tree hollows but also in the wild in natural tree hollows without human assistance. In the course of evolution, over more than 1000 years of isolation in the South Urals, the honey bees of the Burzyan population acquired such characteristics as increased winter hardiness, aggressiveness against bears and other animals, a relatively large colony size that allows keeping the temperature in the family in winter, increased resistance to diseases and parasites [12]. Secondly, the honey bees of the Burzyan population are well adapted to the rapid collection of honey from the linden tree Tilia cordata, which blooms for only one week per year. In the Republic of Bashkortostan, the linden tree and the honey bees of the Burzyan population have mutual co-evolution, as a result of which they acquired a unique co-adaptation to each other [12, 13].
The South Urals and the Republic of Bashkortostan are the region of residence of the local indigenous people - Bashkirs, which historically formed in the Altai. The Republic of Bashkortostan is widely known in the world for the production of unique Bashkir linden honey as a result of the traditional beekeeping of the local indigenous inhabitants of Bashkirs. The preservation of the Burzyan honey bee population means the simultaneous preservation of the ancient traditional beekeeping in the hollows of trees. To preserve the Burzyan population of the dark forest bee, the “Shulgan-Tash” and “Bashkiria” reserves were created in 1986, the “Altyn Solok” reserve - in 1997, the “Bashkirsky Ural” UNESCO reserve - in 2012 (https://whc.unesco.org/en/tentativelists/5666/) [11]. At present, in the Republic of Bashkortostan, hybridization of local honey bees with southern subspecies of honey bees is estimated at 10%, but the Burzyan population of the dark forest bee is protected from hybridization in the Shulgan-Tash reserve, where they are isolated and are under a strict regime of protection and a ban on keeping any agricultural activity [13]. It is recognized that the Burzyan population of the dark forest bee has a unique naturally preserved gene pool of A. m. mellifera, which can be used as a reference genome for comparison, as well as to maintain the genetic diversity of other local populations of the dark forest bees [9, 12, 13, 14]. |
283. Ильясов, Р.А., Марсова, М.В., Ковтун, А.С., Ватлин, А.А., Юнес, Р.А., Гайфуллина, Л.Р., Каскинова, М.Д., Николенко, А.Г., Квон, Х.В., Даниленко, В.Н., 2021. Генетические аспекты сохранения популяций медоносной пчелы Apis mellifera. In: Еськов, Е.К. ed. 5-ая Международная научно-практическая конференция "Пчеловодство холодного и умеренного климата". ФГБОУ ВО «Российский государственный аграрный заочный университет», Москва-Псков, pp. 38-47.
Ilyasov, R.A., Marsova, M.V., Kovtun, A.S., Vatlin, A.A., Younes, R.A., Gaifullina, L.R., Kaskinova, M.D., Nikolenko, A.G., Kwon, H.W., Danilenko, V.N., 2021. Genetic aspects of the conservation of populations of the honeybee Apis mellifera. In: Eskov, E.K. ed. The 5th International Scientific and Practical Conference "Cold and moderate climate beekeeping". Ministry of Agriculture of the Russian Federation "Russian State Agrarian Correspondence University" Moscow-Pskov, pp. 38-47.
Ильясов, Р.А., Марсова, М.В., Ковтун, А.С., Ватлин, А.А., Юнес, Р.А., Гайфуллина, Л.Р., Каскинова, М.Д., Николенко, А.Г., Квон, Х.В., Даниленко, В.Н., 2021. Генетические аспекты сохранения популяций медоносной пчелы Apis mellifera. In: Еськов, Е.К. ed. 5-ая Международная научно-практическая конференция "Пчеловодство холодного и умеренного климата". ФГБОУ ВО «Российский государственный аграрный заочный университет», Москва-Псков, pp. 38-47.
Ilyasov, R.A., Marsova, M.V., Kovtun, A.S., Vatlin, A.A., Younes, R.A., Gaifullina, L.R., Kaskinova, M.D., Nikolenko, A.G., Kwon, H.W., Danilenko, V.N., 2021. Genetic aspects of the conservation of populations of the honeybee Apis mellifera. In: Eskov, E.K. ed. The 5th International Scientific and Practical Conference "Cold and moderate climate beekeeping". Ministry of Agriculture of the Russian Federation "Russian State Agrarian Correspondence University" Moscow-Pskov, pp. 38-47.
Аннотация. Под влиянием факторов окружающей среды и деятельности человека изоляция географических подвидов была нарушена и локальным генофондам подвидов стала угрожать опасность интрогрессивной гибридизации. Идентификация подвидов пчел молекулярно-генетическими методами позволяет снизить процесс гибридизации подвидов. Применение генетических методов в изучении популяции пчел позволяет оценить основные популяционно-генетические характеристики, такие как аллельное и генетическое разнообразие, инбридинг, эффективный размер популяции, эффекты бутылочного горлышка. Знания генетических показателей популяции позволят разработать эффективные стратегии сохранения генофонда подвидов пчел. Показано, что микробиом кишечника вовлечен в модуляцию практически всех систем организма медоносной пчелы и играет важную роль в иммунитете и адаптации пчел к условиям среды обитания. Комплексные исследования генома и метагенома микробиома кишечника пчел могут открыть новые перспективы в консервативной генетике популяций подвидов пчел.
Abstract. Under the influence of environmental factors and human activities, the isolation of geographic subspecies was disrupted and the local gene pools of the subspecies were threatened by the danger of introgressive hybridization. The identification of subspecies of bees by molecular genetic methods makes it possible to reduce the process of hybridization of the subspecies. The use of genetic methods in the study of the population of bees makes it possible to assess the main population genetic characteristics, such as allelic and genetic diversity, inbreeding, effective population size, and bottleneck effects. Knowledge of the genetic parameters of the population will make it possible to develop effective strategies for preserving the gene pool of bee subspecies. It has been shown that the gut microbiome is involved in the modulation of almost all systems of the honeybee and plays an important role in the immunity and adaptation of bees to environmental conditions. Comprehensive studies of the genome and metagenome of the gut microbiome of bees may open up new perspectives in the conservative genetics of populations of subspecies of bees. |
282. Даниленко, В.Н., Ильясов, Р.A., Юнес, Р.А., 2021. Микробиом. Фармабиотики. Нутригеномика. Перспективы использования в постковидную эру. In: Кильчевский, А.В. ed. Жебраковские чтения X. Преобразование геномов. Институт генетики и цитологии Национальной академии наук Беларуси, Минск, pp. 1-44. isbn: 978-985-90552-4-9.
Danilenko, V.N., Ilyasov, R., Younes, R.A., 2021. Microbiome. Pharmabiotics. Nutrigenomics. Prospects for use in the post-covid era. In: Kilchevsky, A.V. ed. Zhebrakovskie readings X. Transformation of genomes. Institute of Genetics and Cytology of the National Academy of Sciences of Belarus, Minsk, pp. 1-44. isbn: 978-985-90552-4-9.
Даниленко, В.Н., Ильясов, Р.A., Юнес, Р.А., 2021. Микробиом. Фармабиотики. Нутригеномика. Перспективы использования в постковидную эру. In: Кильчевский, А.В. ed. Жебраковские чтения X. Преобразование геномов. Институт генетики и цитологии Национальной академии наук Беларуси, Минск, pp. 1-44. isbn: 978-985-90552-4-9.
Danilenko, V.N., Ilyasov, R., Younes, R.A., 2021. Microbiome. Pharmabiotics. Nutrigenomics. Prospects for use in the post-covid era. In: Kilchevsky, A.V. ed. Zhebrakovskie readings X. Transformation of genomes. Institute of Genetics and Cytology of the National Academy of Sciences of Belarus, Minsk, pp. 1-44. isbn: 978-985-90552-4-9.
Резюме. Сегодня всем известны этапы разработки антибактериальных препаратов, включая антибиотики, успехи и проблемы их применения в медицине. Первоначально усилиями ученых всего мира были созданы антибиотики на основе природных продуцентов почвенного происхождения. Широкомасштабное и, порой, нерациональное применение антибактериальных препаратов способствовало появлению и широкому распространению патогенов, устойчивых к большинству антибиотиков. Такая же ситуация складывалась и в области разработки противовирусных и иммуномодулирующих препаратов. Стало очевидным, что человек проигрывает гонку бактериям. Появилась необходимость в создании новых подходов и парадигм в разработке технологий и выбора источников лекарственных средств, в первую очередь противоинфекционных. Успехи последнего десятилетия в области изучения микробиоты человека открыли перед нами много возможностей. Современные знания о структуре и функциях кишечной микробиоты человека и концептуальное объединение знаний о комменсальных микроорганизмах, включая пробиотические, полученные молекулярно-генетическими, транскриптомными, протеомными и метаболомными методами, позволили сформировать понятие фармабиотиков. Создание фармабиотиков на основе микроорганизмов, населяющих различные полости тела человека, включая кишечник, является новым, интенсивно развивающимся направлением фармакологической науки. Поставленные задачи в этой области могут быть решены при условии комплексного решения ряда фундаментальных задач, обеспечивающих создание эффективных и безопасных фармпрепаратов и ингредиентов для них. Пандемия COVID-19 заставила ученых и правительства всех стран мобилизовать усилия для создания новых противовирусных препаратов, изучения механизмов протекания вирусных инфекций и функционирования иммунной и антиоксидантной систем человека. Роль микробиома и фармабиотиков, как селективных модуляторов иммунной системы человека, в первую очередь клеточного иммунитета, а также антиоксидантной системы становится все более очевидной. В течение последнего десятилетия в лаборатории генетики микроорганизмов ИОГен РАН интенсивно проводятся исследования микробиома кишечника человека и разработки препаратов на его основе с нейромодулирующей, иммуномодулирующей и антиоксидантной активностью.
Abstract. Today, everyone knows the stages in the development of antibacterial drugs, including antibiotics, and the successes and problems of their use in medicine. Initially, through the efforts of scientists around the world, antibiotics were created based on the natural producers of soil. Large-scale and irrational use of antibacterial drugs has contributed to the emergence and widespread distribution of pathogens resistant to most antibiotics. The same situation appeared in the development of antiviral and immunomodulatory drugs. It is obvious that humanity is losing the struggle against bacteria. There is a need to create new approaches and paradigms in the development of technologies and the selection of sources of drugs, primarily anti-infectious drugs. The successes of the last decade in the study of the human microbiota have opened up many opportunities for us. Modern knowledge about the structure and functions of the human intestinal microbiota and the conceptual combination of knowledge about commensal microorganisms, including probiotic ones, obtained by molecular genetic, transcriptomic, proteomic, and metabolic methods, allowed us to form the concept of pharmabiotics. The creation of pharmabiotics based on microorganisms inhabiting various cavities of the human body, including the intestine, is a new, intensively developing area of pharmacological science. The tasks set in this area can be solved by ensuring the creation of effective and safe pharmaceuticals and ingredients for them. The COVID-19 pandemic has forced scientists and governments of all countries to mobilize efforts to create new antiviral drugs and study the mechanisms of viral infections and the functioning of the human immune and antioxidant systems. The role of the microbiome and pharmabiotics as selective modulators of the human immune system, primarily cellular immunity, as well as the antioxidant system, is becoming more and more evident. Over the past decade, the laboratory of genetics of microorganisms of the Institute of Genetics of the Russian Academy of Sciences has been intensively conducting research on the human intestinal microbiome and the development of drugs based on it with neuromodulatory, immunomodulatory, and antioxidant activity. |
281. Ильясов Р. А., Марсова М. В., Ковтун А. С., Ватлин А. А., Юнес Р. А., Гайфуллина Л. Р., Каскинова М. Д., Николенко А. Г., Квон Х. В., Даниленко В. Н. Микробиом кишечника медоносной пчелы Apis mellifera – потенциальный иточник биологически активных ингредиентов // Современные достижения в области апидологии / Сагитов С. Т. и др. ‒ Уфа: ФГБОУ ВО «БГПУ им. М. Акмуллы», 2021. ‒ C. 23-30. ISBN: 978-5-907475-05-2
Ilyasov R. A., Marsova M. V., Kovtun A. S., Vatlin A. A., Yunes R. A., Gaifullina L. R., Kaskinova M. D., Nikolenko A. G., Kwon H. W., Danilenko V. N. The gut microbiome of the honey bee Apis mellifera – is a potential source of biologically active ingredients // Modern advances in apidology / Sagitov S. T. et al. ‒ Ufa: FSBEI HE "BSPU named after M. Akmulla", 2021. ‒ P. 23-30. ISBN: 978-5-907475-05-2
Ильясов Р. А., Марсова М. В., Ковтун А. С., Ватлин А. А., Юнес Р. А., Гайфуллина Л. Р., Каскинова М. Д., Николенко А. Г., Квон Х. В., Даниленко В. Н. Микробиом кишечника медоносной пчелы Apis mellifera – потенциальный иточник биологически активных ингредиентов // Современные достижения в области апидологии / Сагитов С. Т. и др. ‒ Уфа: ФГБОУ ВО «БГПУ им. М. Акмуллы», 2021. ‒ C. 23-30. ISBN: 978-5-907475-05-2
Ilyasov R. A., Marsova M. V., Kovtun A. S., Vatlin A. A., Yunes R. A., Gaifullina L. R., Kaskinova M. D., Nikolenko A. G., Kwon H. W., Danilenko V. N. The gut microbiome of the honey bee Apis mellifera – is a potential source of biologically active ingredients // Modern advances in apidology / Sagitov S. T. et al. ‒ Ufa: FSBEI HE "BSPU named after M. Akmulla", 2021. ‒ P. 23-30. ISBN: 978-5-907475-05-2
Аннотация. Микробиом кишечника медоносной пчелы Apis mellifera содержит огра-ниченное количество эволюционно сформировавшихся представителей грамотрицательных (роды Apibacter, Bartonella, Commensalibacter, Gilliamella, Parasaccharibacter, Saccharibacter, Serratia, Snodgrassella, Frischella) и грамположительных бактерий (роды Lactococcus, Lactoba-cillus, Bifidobacterium). Их функции и значимость для отдельной особи и локальной популяции являются в последнее время предметом исследований лабораторий во всем мире. Наш интерес к изучению микробиома кишечника пчелы обусловлен их антимикробным, иммуномодулиру-ющим, нейромодулирующим потенциалом. Лактобактерии и бифидобактерии являются клас-сическими представителями пробиотических бактерий. Их использование в качестве пробио-тиков, парапробиотиков, постбиотиков, ингридиентов в фармокологических препаратах и пер-сонализированных продуктах питания постоянно расширяется. До настоящего времени мик-робиом кишечника медоносной пчелы не использовался в качестве источника пробиотиков. Полный метагеномный анализ микробиома, с использованием алгоритмов поиска заданных генов и их комбинаций, позволяет быстро и эффективно отбирать перспективные штаммы бак-терий. Последующие геномный, транскриптомный, протеомный и метаболомный анализы позволяют отобрать наиболее приемлемые в практическом отношении штаммы. В перспек-тиве, предлагаемая технологическая платформа, отработанная на удобном модельном объекте A. mellifera, позволит использовать ее и на других животных объектах.
Annotation. The gut microbiome of the honey bee Apis mellifera contains a limited number of evolutionarily formed representatives of gram-negative (genera Apibacter, Bartonella, Commen-salibacter, Gilliamella, Parasaccharibacter, Saccharibacter, Serratia, Snodgrassella, Frischella) and gram-positive bacteria (genera Lactococcus, Lactobacillus, Bifidobacterium). Their functions and significance for the individuals and the local population have recently been the subject of research in laboratories around the world. Our interest in the study of the gut microbiome of the honey bees is due to its antimicrobial, immunomodulatory, neuromodulatory potential. Lactobacteria and bifidobacteria are the classic probiotic bacteria. Their use as probiotics, paraprobiotics, postbiotics, pharmaceutical ingredients and personalized food products is constantly expanding. Until now, the honeybee gut microbiome has not been used as a source of probiotics. A complete metagenomic analysis of the microbiome, using algorithms for searching for specified genes and their combina-tions, makes it possible to quickly and efficiently select promising strains of bacteria. Subsequent genomic, transcriptome, proteomic, and metabolomic analyzes make it possible to select the most practically acceptable strains. In the future, the proposed technological platform, tested at a conven-ient model of A. mellifera, allows it to be used on other animals.
|
280. Ильясов, Р.А., Марсова, М.В., Ковтун, А.С., Ватлин, А.А., Юнес, Р.А., Гайфуллина, Л.Р., Каскинова, М.Д., Квон, Х.В., Николенко, А.Г., Даниленко, В.Н., 2021. Роль микробиома кишечника медоносных пчел. Пчеловодство (7), 18-20.
Ильясов, Р.А., Марсова, М.В., Ковтун, А.С., Ватлин, А.А., Юнес, Р.А., Гайфуллина, Л.Р., Каскинова, М.Д., Квон, Х.В., Николенко, А.Г., Даниленко, В.Н., 2021. Роль микробиома кишечника медоносных пчел. Пчеловодство (7), 18-20. (Ilyasov, R.A., Marsova, M.V., Kovtun, A.S., Vatlin, A.A., Yunes, R.A., Gaifullina, L.R., Kaskinova, M.D., Kwon, H.W., Nikolenko, A.G., Danilenko, V.N., 2021. Role of the gut microbiome of the honeybee. Russian Journal of Beekeeping "Pchelovodstvo" (7), 18-20.)
Аннотация. Микробиом кишечника медоносной пчелы Apis mellifera содержит ограниченное количество эволюционно сформировавшихся представителей грамотрицательных (роды Apibacter, Bartonella, Commensalibacter, Gilliamella, Parasaccharibacter, Saccharibacter, Serratia, Snodgrassella, Frischella) и грамположительных бактерий (роды Lactococcus, Lactobacillus, Bifidobacterium). Их функции и значимость для отдельной особи и локальной популяции являются в последнее время предметом исследований лабораторий во всем мире. Наш интерес к изучению микробиома кишечника пчелы обусловлен их антимикробным, иммуномодулирующим, нейромодулирующим потенциалом. Лактобактерии и бифидобактерии являются классическими представителями пробиотических бактерий. Их использование в качестве пробиотиков, парапробиотиков, постбиотиков, ингридиентов в фармокологических препаратах и персонализированных продуктах питания постоянно расширяется. До настоящего времени микробиом кишечника медоносной пчелы не использовался в качестве источника пробиотиков. Полный метагеномный анализ микробиома, с использованием алгоритмов поиска заданных генов и их комбинаций, позволяет быстро и эффективно отбирать перспективные штаммы бактерий. Последующие геномный, транскриптомный, протеомный и метаболомный анализы позволяют отобрать наиболее приемлемые в практическом отношении штаммы. В перспективе, предлагаемая технологическая платформа, отработанная на удобном модельном объекте A. mellifera, позволит использовать ее и на других животных объектах.
Abstract. Our interest in the study of the gut microbiome of the honey bees is due to its antimicrobial, immunomodulatory, neuromodulatory potential. Lactobacteria and bifidobacteria are the classic probiotic bacteria. Their use as probiotics, paraprobiotics, postbiotics, pharmaceutical ingredients and personalized food products is constantly expanding. Until now, the honeybee gut microbiome has not been used as a source of probiotics. A complete metagenomic analysis of the microbiome, using algorithms for searching for specified genes and their combinations, makes it possible to quickly and efficiently select promising strains of bacteria. Subsequent genomic, transcriptome, proteomic, and metabolomic analyzes make it possible to select the most practically acceptable strains. In the future, the proposed technological platform, tested at a convenient model of the honey bee, allows it to be used on other animals. Keywords: Apis mellifera, Lactobacillus, honey bee, gut microbiome, lactic acid bacteria, xenobiotics and pesticides, detoxification. |
279. Ильясов, Р. А., Хан, Г. Ю., Ли, М. Л., Ким, К. В., Парк, Д. Х., Такахаши, Д. И., Квон Х. В., Николенко, А. Г. (2021). Филогенетические отношения подвидов пчел Apis mellifera caucasia и Apis mellifera carpathica по последовательностям митохондриального генома. Генетика, 57(6), 697-710. doi: 10.31857/S0016675821060047.
Ильясов, Р. А., Хан, Г. Ю., Ли, М. Л., Ким, К. В., Парк, Д. Х., Такахаши, Д. И., Квон Х. В., Николенко, А. Г. (2021). Филогенетические отношения подвидов пчел Apis mellifera caucasia и Apis mellifera carpathica по последовательностям митохондриального генома. Генетика, 57(6), 697-710. doi: 10.31857/S0016675821060047.
Аннотация. Последовательности полного митохондриального генома медоносной пчелы Apis mellifera L. подвидов Apis mellifera caucasia Pollmann, 1889 (AP018404, 16341 пн) и Apis mellifera carpathica Foti et al., 1965 (AP018403, 16336 пн) были впервые секвенированы. Митохондриальные ДНК (мтДНК) обоих подвидов содержат 13 кодирующих белок генов, 22 гена тРНК, два гена рРНК и AT-обогащенную регуляторную область. Отношение транзиций к трансверсиям полной мтДНК между A. m. caucasia и A. m. carpathica было 2.05, что характеризует формирование адаптаций к сменяющимся условиям среды обитания. Гены с наибольшим содержанием GC – COX1 (24%), COX2 (19.6%), CYTB (19.1%), COX3 (17.2%) и ND1 (17.2%) могут быть высокополиморфны и использованы в филогенетических и популяционных исследованиях пчел. Большинство генов мтДНК обоих подвидов расположены на тяжелой цепи (девять кодирующих белок генов и 14 генов тРНК), и меньшее число генов (четыре кодирующих белок гена, два гена рРНК и восемь генов тРНК) расположено на легкой цепи. Кластерный анализ последовательности полной мтДНК и оценка структуры межгенной области tRNA-Leu(UUR)–COX2 с единственным элементом Q размером 192 пн показали, что оба подвида являются представителями линии C с гаплотипами C2 и C2j соответственно. Подвиды медоносной пчелы A. m. caucasia и A. m. carpathica могут быть дифференцированы друг от друга по 34 уникальным SNP в 11 генах мтДНК и маркеру рестрикции XbaI в гене ND5. Эти генетические маркеры могут способствовать сохранению чистопородных генофондов пчел подвидов A. m. caucasia и A. m. carpathica в пределах их естественного ареала. |
278. Ilyasov, R. A., Han, G. Y., Lee, M. L., Kim, K. W., Park, J. H., Takahashi, J. I., Kwon, H. W., Nikolenko, A. G. (2021). Phylogenetic relationships among honey bee subspecies Apis mellifera caucasia and Apis mellifera carpathica based on the sequences of the mitochondrial genome. Russian Journal of Genetics, 57(6), 697-710. doi: 10.1134/S1022795421060041.
Ilyasov, R. A., Han, G. Y., Lee, M. L., Kim, K. W., Park, J. H., Takahashi, J. I., Kwon, H. W., Nikolenko, A. G. (2021). Phylogenetic relationships among honey bee subspecies Apis mellifera caucasia and Apis mellifera carpathica based on the sequences of the mitochondrial genome. Russian Journal of Genetics, 57(6), 697-710. doi: 10.1134/S1022795421060041.
Abstract—The sequences of the complete mitochondrial genome of the honey bee Apis mellifera L. subspecies Apis mellifera caucasia Pollmann, 1889 (AP018404, 16341 bp) and Apis mellifera carpathica Foti et al., 1965 (AP018403, 16336 bp) are sequenced for the first time. Mitochondrial DNA (mtDNA) of both subspecies contains 13 protein-coding genes, 22 tRNA genes, two rRNA genes, and one AT-rich regulatory region. The ratio of transitions to transversions (tr/tv) in complete mtDNA between A. m. caucasia and A. m. carpathica was 2.05, which reflects the formation of adaptations to changing environmental conditions. Genes with the highest GC content—COX1 (24%), COX2 (19.6%), CYTB (19.1%), COX3 (17.2%), and ND1 (17.2%)—can be highly polymorphic and can be used in phylogenetic and population studies of bees. The majority of mtDNA genes of both subspecies are located on the heavy strand (9 protein-coding genes and 14 tRNA genes), while other genes (4 protein-coding genes, 2 rRNA genes, and 8 tRNA genes) are located on the light strand. Cluster analysis of the complete mtDNA sequence and assessment of the structure of the tRNA-Leu(UUR)– COX2 intergenic region with a single Q element 192 bp in length showed that both subspecies A. m. caucasia and A. m. carpathica are representatives of the line C with haplotypes C2 and C2j, respectively. Honey bee subspecies A. m. caucasia and A. m. carpathica can be differentiated from each other by 34 unique SNPs in 11 mtDNA genes and the XbaI restriction marker in the ND5 gene. These genetic markers can contribute to the preservation of purebred gene pools of honey bee subspecies A. m. caucasia and A. m. carpathica within their natural range. |
277. Ilyasov, R.A., Takahashi, J.I., Proshchalykin, M.Y., Lelej, A.S., Lee, M.L., Kwon, H.W., Nikolenko, A. G. (2021). First evidence of presence of Varroa underwoodi mites on native Apis cerana colonies in Primorsky Territory of Russia based on COX1 gene. Journal of Apicultural Science 65 (1), 177-186. doi: 10.2478/JAS-2021-0014.
Ilyasov, R.A., Takahashi, J.I., Proshchalykin, M.Y., Lelej, A.S., Lee, M.L., Kwon, H.W., Nikolenko, A. G. (2021). First evidence of presence of Varroa underwoodi mites on native Apis cerana colonies in Primorsky Territory of Russia based on COX1 gene. Journal of Apicultural Science 65 (1), 177-186. doi: 10.2478/JAS-2021-0014.
Abstract. The species of genus Varroa mites parasitize on the honey bees of genus Apis. Unlike the well-studied V. destructor and V. jacobsoni mites, V. underwoodi remain less known. According to English language publications, the proven V. underwoodi distribution area of A. cerana colonies covers Nepal, South Korea, Indonesia, Papua New Guinea, Vietnam and China, but not Russia even though it had been described morphometrically in Russian language publications in Russia’s Primorsky Territory. According to Vavilov’s law (1920) of a homologous series, all the species of V. underwoodi, V. destructor and V. jacobsoni have the ability to spill over onto new hosts. Thus, V. underwoodi is a potential parasite of A. mellifera that should be carefully studied. In this study, V. underwoodi mites in colonies of honey bee subspecies A. c. ussuriensis native to Russia’s Primorsky Territory are first proven using both morphometry and mitochondrial COX1 gene sequencing. The genetic divergence and p-distances between V. underwoodi and other Varroa species ranged from 7 to 10% and from 0.072 to 0.099, respectively, which matched the intraspecific level of differences. Two identical northernmost V. underwoodi samples from Russia’s Primorsky Territory and China’s Jilin province with GenBank accession number MH205176 were assigned as COX1 haplotype China 1 MH205176. The first discovery of V. underwoodi in the Primorsky Territory in northern Asia outlined the northern border of its range. |
276. Ilyasov, R., Lim, S., Lee, M. L., Kwon, H. W., Nikolenko, A. (2021). Effect of miticides amitraz and fluvalinate on reproduction and productivity of honey bee Apis mellifera. Uludag Bee Journal (Uludağ Arıcılık Dergisi), 21(1), 21-30. doi: 10.31467/uluaricilik.883775.
Ilyasov, R., Lim, S., Lee, M. L., Kwon, H. W., Nikolenko, A. (2021). Effect of miticides amitraz and fluvalinate on reproduction and productivity of honey bee Apis mellifera. Uludag Bee Journal (Uludağ Arıcılık Dergisi), 21(1), 21-30. doi: 10.31467/uluaricilik.883775.
ABSTRACT. Varroa destructor is a well-known ectoparasite of the honey bee Apis mellifera. Amitraz and fluvalinate are highly effective miticides used against V. destructor infestation in colonies of honey bee A. mellifera. Though honey bees more resistant to miticides, there are side effects of these chemicals on the reproduction, olfaction, and honey production of honey bees. We showed a negative impact of miticides amitraz and fluvalinate on honey production and reproduction of honey bee colonies. Also, we assumed the reduction of olfaction of honey bees by fluvalinate due to changes of expression of olfactory related neuropeptide genes short neuropeptide F sNPF, tachykinin TK, short neuropeptide F receptor sNPFR. The external treatment of honey bee colonies by miticides amitraz and fluvalinate along with a positive effect of pest control harms reproductivity, honey productivity, and, probably, can reduce learning and memory, gustation and olfaction of honey bees. When used for a short time and with care, miticides can be less harmful to honey bees. Breeding varroa-resistant honey bees allow to reduce the use of miticides and produce organic honey. Therefore, the further development of beekeeping should be in the direction of selection for disease and Varroa resistance and adaptation to the environment. |
275. Momeni, J., Parejo, M., Nielsen, R.O., Langa, J., Montes, I., Ilyasov, R., et al., 2021. Authoritative subspecies diagnosis tool for European honey bees based on ancestry informative SNPs. BMC Genomics 22 (1), 101. doi: 10.1186/s12864-021-07379-7.
Momeni, J., Parejo, M., Nielsen, R.O., Langa, J., Montes, I., Ilyasov, R., et al., 2021. Authoritative subspecies diagnosis tool for European honey bees based on ancestry informative SNPs. BMC Genomics 22 (1), 101. doi: 10.1186/s12864-021-07379-7.
With numerous endemic subspecies representing four of its five evolutionary lineages, Europe holds a large fraction of Apis mellifera genetic diversity. This diversity and the natural distribution range have been altered by anthropogenic factors. The conservation of this natural heritage relies on the availability of accurate tools for subspecies diagnosis. Based on pool-sequence data from 2145 worker bees representing 22 populations sampled across Europe, we employed two highly discriminative approaches (PCA and FST) to select the most informative SNPs for ancestry inference. Results: Using a supervised machine learning (ML) approach and a set of 3896 genotyped individuals, we could show that the 4094 selected single nucleotide polymorphisms (SNPs) provide an accurate prediction of ancestry inference in European honey bees. The best ML model was Linear Support Vector Classifier (Linear SVC) which correctly assigned most individuals to one of the 14 subspecies or different genetic origins with a mean accuracy of 96.2% ± 0.8 SD. A total of 3.8% of test individuals were misclassified, most probably due to limited differentiation between the subspecies caused by close geographical proximity, or human interference of genetic integrity of reference subspecies, or a combination thereof. Conclusions: The diagnostic tool presented here will contribute to a sustainable conservation and support breeding activities in order to preserve the genetic heritage of European honey bees. Keywords: Apis mellifera, European subspecies, Conservation, Machine learning, Prediction, Biodiversity
С многочисленными эндемичными подвидами, представляющими четыре из пяти эволюционных линий, Европа обладает значительной долей генетического разнообразия Apis mellifera. Это разнообразие и естественный ареал распространения были изменены антропогенными факторами. Сохранение этого природного наследия зависит от наличия точных инструментов для диагностики подвидов. Основываясь на данных пула последовательностей от 2145 рабочих пчел, представляющих 22 популяции, отобранные по всей Европе, мы использовали два высокодискриминационных подхода (PCA и FST) для выбора наиболее информативных SNP для определения происхождения. Результаты: Используя подход контролируемого машинного обучения (ML) и набор из 3896 генотипированных особей, мы смогли показать, что 4094 выбранных однонуклеотидных полиморфизма (SNP) обеспечивают точное предсказание происхождения происхождения европейских медоносных пчел. Лучшей моделью ML был линейный классификатор опорных векторов (Linear SVC), который правильно отнес большинство людей к одному из 14 подвидов или различному генетическому происхождению со средней точностью 96,2% ± 0,8 SD. В общей сложности 3,8% испытуемых были неправильно классифицированы, скорее всего, из-за ограниченной дифференциации между подвидами, вызванной географической близостью, или вмешательством человека в генетическую целостность эталонных подвидов, или их комбинацией. Выводы. Представленный здесь диагностический инструмент будет способствовать устойчивому сохранению и поддержке селекционной деятельности с целью сохранения генетического наследия европейских медоносных пчел. Ключевые слова: Apis mellifera, европейский подвид, сохранение, машинное обучение, прогнозирование, биоразнообразие. |
274. Kim, D.-I., Ilyasov, R.A., Yunusbaev, U.B., Lee, S.-H., Kwon, H.W., 2021. Behavioral and molecular responses of Aedes aegypti to ultrasound. Journal of Asia-Pacific Entomology 24 (1), 429-435. doi: 10.1016/j.aspen.2020.12.016.
Kim, D.-I., Ilyasov, R.A., Yunusbaev, U.B., Lee, S.-H., Kwon, H.W., 2021. Behavioral and molecular responses of Aedes aegypti to ultrasound. Journal of Asia-Pacific Entomology 24 (1), 429-435. doi: 10.1016/j.aspen.2020.12.016.
Mosquito-borne infectious diseases cause mortality and global infectious disease burden worldwide. There are several electronic mosquito repellents (EMRs) based on ultrasound have been developed and commercialized to reduce human-mosquito contacts. However, the efficacy of EMRs against mosquitoes is still unclear. In this study, we present experimental evidence that ultrasound of different frequency and sound pressure differentially affects the host-seeking behavior of Aedes aegypti females. Behavioral tests were accompanied by molecular experiments to check whether mosquitoes respond to ultrasound and are there any changes in specific mRNA expression. Experiments in bioassays revealed that the ultrasound of 100 kHz frequency and 90–110 dB pressure significantly disrupted CO₂-oriented olfactory behaviors and blocked indoor invasion. Furthermore, a long time (>24 h) exposure to 100 kHz frequency/90 dB pressure of ultrasound decreased attractive behaviors to human skin. At the molecular level, there was no change in expression of odorant receptor co-receptor (AaOrco) in ultrasound treated animals, while one of the CO2 receptor genes, AaGr3, and putative hearing-related gene, AAEL009258, were down-regulated and up-regulated, respectively. Our study indicates that high frequency (100 kHz) and pressure (90–110 dB) of the ultrasound has repellent effects to olfactory–driven behaviors of mosquitoes.
Инфекционные заболевания, переносимые комарами, являются причиной смертности и глобального бремени инфекционных заболеваний во всем мире. Существует несколько электронных репеллентов от комаров (ЭМИ) на основе ультразвука, которые были разработаны и коммерциализированы для уменьшения контактов человека с комарами. Однако эффективность ЭМИ против комаров до сих пор неясна. В этом исследовании мы представляем экспериментальные доказательства того, что ультразвук разной частоты и звукового давления по-разному влияет на поведение самок Aedes aegypti в поисках хозяина. Поведенческие тесты сопровождались молекулярными экспериментами, чтобы проверить, реагируют ли комары на ультразвук и есть ли какие-либо изменения в специфической экспрессии мРНК. Эксперименты по биопробам показали, что ультразвук с частотой 100 кГц и давлением 90–110 дБ значительно нарушает CO-ориентированное обонятельное поведение и блокирует вторжение в помещение. Кроме того, длительное (> 24 ч) воздействие ультразвука частотой 100 кГц / давлением 90 дБ снижает привлекательность кожи человека. На молекулярном уровне не было изменений в экспрессии корецептора рецептора запаха (AaOrco) у животных, обработанных ультразвуком, в то время как один из генов рецептора CO2, AaGr3, и предполагаемый ген, связанный со слухом, AAEL009258, подавлялись и повышались. -регулируемые соответственно. Наше исследование показывает, что высокая частота (100 кГц) и давление (90–110 дБ) ультразвука имеют репеллентный эффект на обонятельное поведение комаров. |
273. Ilyasov R. A., Han G. Y., Lee M. L., Kim K. W., Proshchalykin M. Y., Lelej A. S., Park J. H., Takahashi J. I., Kwon H. W., Nikolenko A. G. Genetic properties and evolution of asian honey bee Apis cerana ussuriensis from Primorsky Krai, Russia. Russian Journal of Genetics. 2021. 57(5). P. 557-571. DOI: 10.1134/S1022795421050033.
Ilyasov R. A., Han G. Y., Lee M. L., Kim K. W., Proshchalykin M. Y., Lelej A. S., Park J. H., Takahashi J. I., Kwon H. W., Nikolenko A. G. Genetic properties and evolution of asian honey bee Apis cerana ussuriensis from Primorsky Krai, Russia. Russian Journal of Genetics. 2021. 57(5). P. 557-571. DOI: 10.1134/S1022795421050033.
Apis cerana ussuriensis Ilyasov et al., 2019 is the northernmost subspecies of the Asian honey bee A. cerana Fabricius, 1793, common in the forests of Primorsky krai and Khabarovsk krai as far as 47°54′ N. Genetic studies of this subspecies are of great interest for science and apiculture, since all its adaptive traits were formed under the influence of the natural environment without human interference. We sequenced and annotated the complete mitochondrial DNA (mtDNA) sequences of bees of subspecies Apis cerana ussuriensis Ilyasov et al., 2019 (Genbank accession number AP018450) from Primorsky krai and Apis cerana koreana Ilyasov et al., 2019 from South Korea, as well as six exons of the nuclear DNA (nDNA) vitellogenin VG E2– E7 gene of bee subspecies A. c. ussuriensis, A. c. koreana, A. c. japonica Radoszkowski, 1887, A. c. cerana, and A. c. indica Fabricius, 1798. Cluster analysis of the mtDNA and the nDNA VG gene sequences showed the division of bees into two groups, the southern subspecies A. c. indica and the northern subspecies A. c. ussuriensis, A. c. koreana, A. c. japonica, and A. c. cerana. On the basis of the genetic divergence, we showed that subspecies A. c. ussuriensis was genetically closer to subspecies A. c. japonica, A. c. koreana, and A. c. cerana than to subspecies A. c. indica. Values of genetic divergence (0.80%–8.00%) and Jukes–Cantor genetic distance (0.005–0.100) for mtDNA and nDNA VG gene between subspecies A. c. ussuriensis, A. c. koreana, A. c. japonica, A. c. cerana, and A. c. indica are within the range of intraspecific differences between insect subspecies. The estimated time of the emergence of the A. cerana subspecies is from two to one million years ago. |
272. Ильясов Р. А., Хан Г. Ю., Ли М. Л., Ким К. В., Прощалыкин М. Ю., Лелей А. С., Парк Д. Х., Такахаши Д. И., Квон Х. В., Николенко А. Г. Генетические показатели и эволюция уссурийской восковой пчелы Apis cerana ussuriensis из Приморского края России. Генетика. 2021. T. 57, № 5. C. 557-571. DOI: 10.31857/s0016675821050039.
Ильясов Р. А., Хан Г. Ю., Ли М. Л., Ким К. В., Прощалыкин М. Ю., Лелей А. С., Парк Д. Х., Такахаши Д. И., Квон Х. В., Николенко А. Г. Генетические показатели и эволюция уссурийской восковой пчелы Apis cerana ussuriensis из Приморского края России. Генетика. 2021. T. 57, № 5. C. 557-571. DOI: 10.31857/s0016675821050039.
Apis cerana ussuriensis Ilyasov et al., 2019 – самый северный подвид восковой пчелы A. cerana Fabricius, 1793, распространенный в лесах Приморского и Хабаровского краев до 47°54′ с.ш. Генетические исследования этого подвида представляют большой интерес для науки и пчеловодства, поскольку все адаптивные признаки сформировались под действием окружающей среды без участия человека. Мы секвенировали и аннотировали последовательности полной митохондриальной ДНК (мтДНК) пчел подвидов Apis cerana ussuriensis Ilyasov et al., 2019 (номер в Генбанке AP018450) из Приморского края и Apis cerana koreana Ilyasov et al., 2019 (AP018431) из Южной Кореи и шести экзонов гена вителлогенина VG E2–E7 ядерной ДНК (яДНК) подвидов пчел A. c. ussuriensis, A. c. koreana, A. c. japonica Radoszkowski, 1887, A. c. cerana и A. c. indica Fabricius, 1798. Методом кластерного анализа последовательностей мтДНК и гена VG яДНК было показано разделение пчел на две группы, включающие южный подвид A. c. indica и северные подвиды A. c. ussuriensis, A. c. koreana, A. c. japonica, A. c. cerana. На основе генетической дивергенции было показано, что подвид A. c. ussuriensis генетически ближе к подвидам A. c. japonica, A. c. koreana и A. c. cerana чем к подвиду A. c. indica. Значения генетической дивергенции (0.80–8.00%) и генетической дистанции Jukes–Cantor (0.005–0.100) по мтДНК и гену VG яДНК между подвидами A. c. ussuriensis, A. c. koreana, A. c. japonica, A. c. cerana, A. c. indica находятся в пределах внутривидовых различий между подвидами насекомых. Предположительное время возникновения подвидов A. cerana – от двух до одного млн лет назад. |
271. Ильясов Р.А., Хан Г.Ю., Ли М.Л., Ким К.В., Парк Д.Х., Такахаши Д.И., Квон Х.В., Николенко А.Г. Эволюционные взаимоотношения кавказской и карпатской популяций медоносной пчелы. Часть 2. Пчеловодство, 4, 2021. С. 16-20. (Ilyasov R.A., Han G.Y., Lee M.L., Kim K.W., Park J.H., Takahashi J.I., Kwon H.W., Nikolenko A.G. Evolutionary relationships of caucasian Apis mellifera caucasia and carpathian Apis mellifera carpathica poplations of the honey bee. Part 2. Russian Journal of Beekeeping "Pchelovodstvo", Issue 4, 2021. P. 16-20.)
Ильясов Р.А., Хан Г.Ю., Ли М.Л., Ким К.В., Парк Д.Х., Такахаши Д.И., Квон Х.В., Николенко А.Г. Эволюционные взаимоотношения кавказской и карпатской популяций медоносной пчелы. Часть 2. Пчеловодство, 4, 2021. С. 16-20. (Ilyasov R.A., Han G.Y., Lee M.L., Kim K.W., Park J.H., Takahashi J.I., Kwon H.W., Nikolenko A.G. Evolutionary relationships of caucasian Apis mellifera caucasia and carpathian Apis mellifera carpathica poplations of the honey bee. Part 2. Russian Journal of Beekeeping "Pchelovodstvo", Issue 4, 2021. P. 16-20.)
Впервые секвенированы оследовательности полного митохондриального генома подвидов пчел Apis mellifera caucasia Pollmann, 1889 (AP018404, 16341 п.н.) и Apis mellifera carpathica Foti et al., 1965 (AP018403, 16336 п.н.). Митохондриальные ДНК (мтДНК) обоих подвидов содержат 13 кодирующих белок генов, 22 гена тРНК, 2 гена рРНК и AT-обогащенную регуляторную область. Отношение транзиций к трансверсиям tr/tv полной мтДНК между A. m. caucasia и A. m. carpathica соответствует 2,05, что характеризует формирование адаптаций к сменяющимся условиям среды обитания. Гены с наибольшим содержанием GC — COX1, COX2, CYTB, COX3 и ND1 могут быть высокополиморфны и использованы в филогенетических и популяционных исследованиях пчел. Большинство генов мтДНК обоих подвидов расположены на тяжелой цепи и меньшее количество — на легкой цепи. Кластерный анализ последовательности полной мтДНК и оценка структуры межгенной области тРНК-Leu(UUR)-COX2 с единственным элементом Q размером 192 п.н. показали, что A. m. caucasia и A. m. carpathica являются представителями линии C с гаплотипами C2 и C2j соответственно. Указанные подвиды можно дифференцировать друг от друга по 34 уникальным SNP в 11 генах мтДНК и маркеру рестрикции XbaI в гене ND5. Эти генетические маркеры могут способствовать сохранению чистопородных генофондов A. m. caucasia и A. m. carpathica в пределах их естественного ареала. Ключевые слова: Apis mellifera, подвиды пчел, A. m. caucasia, A. m. carpathica, митохондриальный геном, мтДНК, гаплотипы, консервативная генетика.
The sequences of the complete mitochondrial genome of the honey bee subspecies Apis mellifera caucasia Pollmann, 1889 (AP018404, 16341 bp) and Apis mellifera carpathica Foti et al., 1965 (AP018403, 16336 bp) were first sequenced. Mitochondrial DNA (mtDNA) of both subspecies contains 13 protein-coding genes, 22 tRNA genes, 2 rRNA genes and 1 AT-rich regulatory region. The ratio of transitions to transversions tr/tv in complete mtDNA between A. m. caucasia and A. m. carpathica was 2.05, which characterizes the formation of adaptations to changing environmental conditions. Genes with the highest GC content — COX1 (24%), COX2 (19.6%), CYTB (19.1%), COX3 (17.2%) and ND1 (17.2%) can be highly polymorphic and used in phylogenetic and population studies of bees. Most of mtDNA genes for both subspecies are located on the heavy chain (9 protein coding genes and 14 tRNA genes) and fewer genes (4 protein coding genes, 2 rRNA genes and 8 tRNA genes) are located on the light chain. Cluster analysis of the complete mtDNA sequence and assessment of the structure of the tRNA-Leu(UUR)-COX2 intergenic region with a single Q element of 192 bp showed that both subspecies A. m. caucasia and A. m. carpathica are representatives of the line C with haplotypes C2 and C2j, respectively. Subspecies of the honey bee A. m. caucasia and A. m. carpathica can be differentiated from each other by 34 unique SNPs in 11 mtDNA genes and the XbaI restriction marker in the ND5 gene. These genetic markers can contribute to the preservation of purebred gene pools of honey bee subspecies A. m. caucasia and A. m. carpathica within their natural range. Keywords: Apis mellifera, honeybee subspecies, A. m. caucasia, A. m. carpathica, mitochondrial genome, mtDNA, haplotypes, conservation genetics. |
270. Ильясов Р.А., Хан Г.Ю., Ли М.Л., Ким К.В., Парк Д.Х., Такахаши Д.И., Квон Х.В., Николенко А.Г. Эволюционные взаимоотношения кавказской и карпатской популяций медоносной пчелы. Часть 1. Пчеловодство, 3, 2021. С. 16-19. (Ilyasov R.A., Han G.Y., Lee M.L., Kim K.W., Park J.H., Takahashi J.I., Kwon H.W., Nikolenko A.G. Evolutionary relationships of caucasian Apis mellifera caucasia and carpathian Apis mellifera carpathica poplations of the honey bee. Part 1. Russian Journal of Beekeeping "Pchelovodstvo", Issue 3, 2021. P. 16-19.)
Ильясов Р.А., Хан Г.Ю., Ли М.Л., Ким К.В., Парк Д.Х., Такахаши Д.И., Квон Х.В., Николенко А.Г. Эволюционные взаимоотношения кавказской и карпатской популяций медоносной пчелы. Часть 1. Пчеловодство, 3, 2021. С. 16-19. (Ilyasov R.A., Han G.Y., Lee M.L., Kim K.W., Park J.H., Takahashi J.I., Kwon H.W., Nikolenko A.G. Evolutionary relationships of caucasian Apis mellifera caucasia and carpathian Apis mellifera carpathica poplations of the honey bee. Part 1. Russian Journal of Beekeeping "Pchelovodstvo", Issue 3, 2021. P. 16-19.)
Впервые секвенированы оследовательности полного митохондриального генома подвидов пчел Apis mellifera caucasia Pollmann, 1889 (AP018404, 16341 п.н.) и Apis mellifera carpathica Foti et al., 1965 (AP018403, 16336 п.н.). Митохондриальные ДНК (мтДНК) обоих подвидов содержат 13 кодирующих белок генов, 22 гена тРНК, 2 гена рРНК и AT-обогащенную регуляторную область. Отношение транзиций к трансверсиям tr/tv полной мтДНК между A. m. caucasia и A. m. carpathica соответствует 2,05, что характеризует формирование адаптаций к сменяющимся условиям среды обитания. Гены с наибольшим содержанием GC — COX1, COX2, CYTB, COX3 и ND1 могут быть высокополиморфны и использованы в филогенетических и популяционных исследованиях пчел. Большинство генов мтДНК обоих подвидов расположены на тяжелой цепи и меньшее количество — на легкой цепи. Кластерный анализ последовательности полной мтДНК и оценка структуры межгенной области тРНК-Leu(UUR)-COX2 с единственным элементом Q размером 192 п.н. показали, что A. m. caucasia и A. m. carpathica являются представителями линии C с гаплотипами C2 и C2j соответственно. Указанные подвиды можно дифференцировать друг от друга по 34 уникальным SNP в 11 генах мтДНК и маркеру рестрикции XbaI в гене ND5. Эти генетические маркеры могут способствовать сохранению чистопородных генофондов A. m. caucasia и A. m. carpathica в пределах их естественного ареала. Ключевые слова: Apis mellifera, подвиды пчел, A. m. caucasia, A. m. carpathica, митохондриальный геном, мтДНК, гаплотипы, консервативная генетика.
The sequences of the complete mitochondrial genome of the honey bee subspecies Apis mellifera caucasia Pollmann, 1889 (AP018404, 16341 bp) and Apis mellifera carpathica Foti et al., 1965 (AP018403, 16336 bp) were first sequenced. Mitochondrial DNA (mtDNA) of both subspecies contains 13 protein-coding genes, 22 tRNA genes, 2 rRNA genes and 1 AT-rich regulatory region. The ratio of transitions to transversions tr/tv in complete mtDNA between A. m. caucasia and A. m. carpathica was 2.05, which characterizes the formation of adaptations to changing environmental conditions. Genes with the highest GC content — COX1 (24%), COX2 (19.6%), CYTB (19.1%), COX3 (17.2%) and ND1 (17.2%) can be highly polymorphic and used in phylogenetic and population studies of bees. Most of mtDNA genes for both subspecies are located on the heavy chain (9 protein coding genes and 14 tRNA genes) and fewer genes (4 protein coding genes, 2 rRNA genes and 8 tRNA genes) are located on the light chain. Cluster analysis of the complete mtDNA sequence and assessment of the structure of the tRNA-Leu(UUR)-COX2 intergenic region with a single Q element of 192 bp showed that both subspecies A. m. caucasia and A. m. carpathica are representatives of the line C with haplotypes C2 and C2j, respectively. Subspecies of the honey bee A. m. caucasia and A. m. carpathica can be differentiated from each other by 34 unique SNPs in 11 mtDNA genes and the XbaI restriction marker in the ND5 gene. These genetic markers can contribute to the preservation of purebred gene pools of honey bee subspecies A. m. caucasia and A. m. carpathica within their natural range. Keywords: Apis mellifera, honeybee subspecies, A. m. caucasia, A. m. carpathica, mitochondrial genome, mtDNA, haplotypes, conservation genetics. |
269. Ilyasov, R.A., Lee, M.-L., Takahashi, J.-I., Kwon, H.W., Nikolenko, A.G., 2020. A revision of subspecies structure of western honey bee Apis mellifera. Saudi Journal of Biological Sciences 27 (12), 3615-3621. https://doi.org/10.1016/j.sjbs.2020.08.001.
Ilyasov, R.A., Lee, M.-L., Takahashi, J.-I., Kwon, H.W., Nikolenko, A.G., 2020. A revision of subspecies structure of western honey bee Apis mellifera. Saudi Journal of Biological Sciences 27 (12), 3615-3621. https://doi.org/10.1016/j.sjbs.2020.08.001.
Abstract.The taxonomy of honey bee A. mellifera contains a lot of issues due to the specificity of population structure, features of biology and resolutions of honey bee subspecies discrimination methods. There are a lot of transition zones between ranges of subspecies which led to the gradual changes of characteristics among neighbor subspecies. The modern taxonomic pattern of honey bee Apis mellifera is given in this paper. Thirty-three distinct honey bee subspecies are distributed across all Africa (11 subspecies), Western Asia and the Middle East (9 subspecies), and Europe (13 subspecies). All honey bee subspecies are subdivided into 5 evolutionary lineages: lineage A (10 subspecies) and its sublineage Z (3 subspecies), lineage M (3 subspecies), lineage C (10 subspecies), lineage O (3 subspecies), lineage Y (1 subspecies), lineage C or O (3 subspecies).
|
268. Ильясов Р.А., Николенко А.Г., Квон Х.В. Генетическое улучшение медоносной пчелы для разведения в экстремальных климатических условиях. Сборник статей V Международной конференции "Концептуальные и прикладные аспекты научных исследований и образования в области зоологии беспозвоночных". 328 с. Томск: Издательство Томского государственного университета, 26–28 октября 2020. 214-217 с. DOI: 10.17223/978-5-94621-931-0-2020-55 ISBN: 978-5-94621-931-0.
Ilyasov R.A., Nikolenko A.G., Kwon H.W. Genetic improvement of honey bees for keeping in extremal climatic conditions. In: Proceedings of V International conference "Conceptual and applied aspects of scientific research and education in the field of invertebrate zoology" 328 p. Tomsk, Russia: Tomsk State University. October 26-28, 2020. 214-217 pp. DOI: 10.17223/978-5-94621-931-0-2020-55 ISBN: 978-5-94621-931-0.
Ильясов Р.А., Николенко А.Г., Квон Х.В. Генетическое улучшение медоносной пчелы для разведения в экстремальных климатических условиях. Сборник статей V Международной конференции "Концептуальные и прикладные аспекты научных исследований и образования в области зоологии беспозвоночных". 328 с. Томск: Издательство Томского государственного университета, 26–28 октября 2020. 214-217 с. DOI: 10.17223/978-5-94621-931-0-2020-55 ISBN: 978-5-94621-931-0.
Ilyasov R.A., Nikolenko A.G., Kwon H.W. Genetic improvement of honey bees for keeping in extremal climatic conditions. In: Proceedings of V International conference "Conceptual and applied aspects of scientific research and education in the field of invertebrate zoology" 328 p. Tomsk, Russia: Tomsk State University. October 26-28, 2020. 214-217 pp. DOI: 10.17223/978-5-94621-931-0-2020-55 ISBN: 978-5-94621-931-0.
Аннотация. Генетическое улучшение популяций медоносных пчел с использованием молекулярно-генетических методов происходит быстрее и точнее по сравнению с морфометрическими и этологическими методами. Мы разработали метод, основанный на девяти ядерных микросателлитных локусах, который позволяет отбирать наиболее адаптивные колонии медоносных пчел по генетически определенным признакам. Наше исследование гетерозиготности темной европейской пчелы A. m. mellifera, обитающей в холодном климате Урала, позволяет проводить селекцию семей, хорошо адаптированных к экстремальным климатическим условиям.
Abstract. Genetic improvement of honey bee populations based on molecular genetics features is faster and precision in comparison with morphometry and behavior-based methods. We developed the method based on nine nuclear microsatellite loci that allow a selection of most adaptive honey bee colonies by genetically defined features. Our study the heterozygosity of the dark European bee A. m. mellifera inhabiting the extremely cold region of the Ural Mountains to provide a marker-assisted selection for revealing the high adapted to extremely cold climate honey bee population can be applied for marker-assisted selection of honey bees adapted to beekeeping in extremal climatic conditions.
|
267. Ильясов Р.А., Хан Г.Ю., Ли М.Л., Ким К.В., Прощалыкин М.Ю., Лелей А.С., Такахаши Д.И., Квон Х.В., Николенко А.Г. Эволюционные взаимоотношения корейской и уссурийской популяций восковой пчелы. Часть 2. Пчеловодство, 9, 2020. С. 58-62.
Ilyasov R.A., Han G.Y., Lee M.L., Kim K.W., Proshchalykin M.Y., Lelei A.S., Takahashi D.I., Kwon H.W., Nikolenko A .G. Evolutionary relationships between the Korean and Ussuri populations of the wax bee. Part 2. Russian Journal of Beekeeping "Pchelovodstvo", Issue 9, 2020. P. 58-62.
Ильясов Р.А., Хан Г.Ю., Ли М.Л., Ким К.В., Прощалыкин М.Ю., Лелей А.С., Такахаши Д.И., Квон Х.В., Николенко А.Г. Эволюционные взаимоотношения корейской и уссурийской популяций восковой пчелы. Часть 2. Пчеловодство, 9, 2020. С. 58-62.
Ilyasov R.A., Han G.Y., Lee M.L., Kim K.W., Proshchalykin M.Y., Lelei A.S., Takahashi D.I., Kwon H.W., Nikolenko A .G. Evolutionary relationships between the Korean and Ussuri populations of the wax bee. Part 2. Russian Journal of Beekeeping "Pchelovodstvo", Issue 9, 2020. P. 58-62.
Аннотация.Apis cerana ussuriensis Ilyasov et al., 2019 самый северный подвид восковой пчелы A. cerana Fabricius, 1793, распространенный в лесах Приморского и Хабаровского краев до 47°54' с.ш. Генетические исследования этого подвида представляет большой интерес для науки и пчеловодства, поскольку все адаптивные признаки сформировались под действием окружающей среды без участия человека. Мы секвенировали и аннотировали последовательности полной митохондриальной ДНК (мтДНК) пчел подвидов Apis cerana ussuriensis Ilyasov et al., 2019 (AP018450) из Приморского края и Apis cerana koreana Ilyasov et al., 2019 (AP018431) из Южной Кореи и шести экзонов гена вителлогенина VG E2-E7 ядерной ДНК (яДНК) подвидов пчел A. c. ussuriensis, A. c. koreana, A. c. japonica Radoszkowski, 1887, A. c. cerana и A. c. indica Fabricius, 1798. Методом кластерного анализа последовательностей мтДНК и гена VG яДНК было показано разделение пчел на две группы, включающие южный подвид A. c. indica и северные подвиды A. c. ussuriensis, A. c. koreana, A. c. japonica и A. c. cerana. На основе генетической дивергенции было показано, что подвид A. c. ussuriensis генетически близок с подвидами A. c. japonica, A. c. koreana и A. c. cerana чем с подвидом A. c. indica. Значения генетической дивергенции (0,80% - 8,00%) и генетической дистанции Jukes-Cantor (0,005 - 0,100) по мтДНК и гену VG яДНК между подвидами A. c. ussuriensis, A. c. koreana, A. c. japonica, A. c. cerana, A. c. indica находятся в пределах внутривидовых различий между подвидами насекомых. Предположительное время возникновение подвидов A. cerana было оценено от 2 до 1 млн. лет назад.
Abstract. A. c. ussuriensis Ilyasov et al., 2019 is the most northern subspecies of the honey bee A. cerana, distributed in the taiga of Primorsky and Khabarovsky territories up to 48°N. Genetic studies of this subspecies are of great interest for science and beekeeping, since all adaptive characters were formed under the influence of the environment without human intervention. We sequenced and annotated the complete mitochondrial DNA (mtDNA) sequences of honey bee subspecies Apis cerana ussuriensis Ilyasov et al., 2019 (AP018450) from Primorsky Territory and Apis cerana koreana Ilyasov et al., 2019 (AP018431) from South Korea and six exons of the gene vitellogenin VG E2-E7 of nuclear DNA (nDNA) of honey bee subspecies A. c. ussuriensis, A. c. koreana, A. c. japonica Radoszkowski, 1887, A. c. cerana, and A. c. indica Fabricius, 1798. The method of cluster analysis of the sequences of mtDNA and the gene VG of nDNA showed the separation of bees into two groups, including the southern subspecies A. c. indica and northern subspecies A. c. ussuriensis, A. c. koreana, A. c. japonica, and A. c. cerana. Based on genetic divergence, it was shown that the subspecies A. c. ussuriensis is genetically close to A. c. japonica, A. c. koreana and A. c. cerana than with a subspecies A. c. indica. Values of genetic divergence (0.80% - 8.00%) and Jukes-Cantor genetic distance (0.005 - 0.100) for mtDNA and gene VG of nDNA between A. subspecies c. ussuriensis, A. c. koreana, A. c. japonica, A. c. cerana, A. c. indica are within intraspecies differences between insect subspecies. The estimated time of origin of A. cerana subspecies was rated about 2–1 million years ago. |
266. Ильясов Р.А., Хан Г.Ю., Ли М.Л., Ким К.В., Прощалыкин М.Ю., Лелей А.С., Такахаши Д.И., Квон Х.В., Николенко А.Г. Эволюционные взаимоотношения корейской и уссурийской популяций восковой пчелы. Часть 1. Пчеловодство, 8, 2020. С. 62-64.
Ilyasov R.A., Han G.Y., Lee M.L., Kim K.W., Proshchalykin M.Y., Lelei A.S., Takahashi D.I., Kwon H.W., Nikolenko A .G. Evolutionary relationships between the Korean and Ussuri populations of the wax bee. Part 1. Russian Journal of Beekeeping "Pchelovodstvo", Issue 8, 2020. P. 62-64.
Ильясов Р.А., Хан Г.Ю., Ли М.Л., Ким К.В., Прощалыкин М.Ю., Лелей А.С., Такахаши Д.И., Квон Х.В., Николенко А.Г. Эволюционные взаимоотношения корейской и уссурийской популяций восковой пчелы. Часть 1. Пчеловодство, 8, 2020. С. 62-64.
Ilyasov R.A., Han G.Y., Lee M.L., Kim K.W., Proshchalykin M.Y., Lelei A.S., Takahashi D.I., Kwon H.W., Nikolenko A .G. Evolutionary relationships between the Korean and Ussuri populations of the wax bee. Part 1. Russian Journal of Beekeeping "Pchelovodstvo", Issue 8, 2020. P. 62-64.
Аннотация.Apis cerana ussuriensis Ilyasov et al., 2019 самый северный подвид восковой пчелы A. cerana Fabricius, 1793, распространенный в лесах Приморского и Хабаровского краев до 47°54' с.ш. Генетические исследования этого подвида представляет большой интерес для науки и пчеловодства, поскольку все адаптивные признаки сформировались под действием окружающей среды без участия человека. Мы секвенировали и аннотировали последовательности полной митохондриальной ДНК (мтДНК) пчел подвидов Apis cerana ussuriensis Ilyasov et al., 2019 (AP018450) из Приморского края и Apis cerana koreana Ilyasov et al., 2019 (AP018431) из Южной Кореи и шести экзонов гена вителлогенина VG E2-E7 ядерной ДНК (яДНК) подвидов пчел A. c. ussuriensis, A. c. koreana, A. c. japonica Radoszkowski, 1887, A. c. cerana и A. c. indica Fabricius, 1798. Методом кластерного анализа последовательностей мтДНК и гена VG яДНК было показано разделение пчел на две группы, включающие южный подвид A. c. indica и северные подвиды A. c. ussuriensis, A. c. koreana, A. c. japonica и A. c. cerana. На основе генетической дивергенции было показано, что подвид A. c. ussuriensis генетически близок с подвидами A. c. japonica, A. c. koreana и A. c. cerana чем с подвидом A. c. indica. Значения генетической дивергенции (0,80% - 8,00%) и генетической дистанции Jukes-Cantor (0,005 - 0,100) по мтДНК и гену VG яДНК между подвидами A. c. ussuriensis, A. c. koreana, A. c. japonica, A. c. cerana, A. c. indica находятся в пределах внутривидовых различий между подвидами насекомых. Предположительное время возникновение подвидов A. cerana было оценено от 2 до 1 млн. лет назад.
Abstract. A. c. ussuriensis Ilyasov et al., 2019 is the most northern subspecies of the honey bee A. cerana, distributed in the taiga of Primorsky and Khabarovsky territories up to 48°N. Genetic studies of this subspecies are of great interest for science and beekeeping, since all adaptive characters were formed under the influence of the environment without human intervention. We sequenced and annotated the complete mitochondrial DNA (mtDNA) sequences of honey bee subspecies Apis cerana ussuriensis Ilyasov et al., 2019 (AP018450) from Primorsky Territory and Apis cerana koreana Ilyasov et al., 2019 (AP018431) from South Korea and six exons of the gene vitellogenin VG E2-E7 of nuclear DNA (nDNA) of honey bee subspecies A. c. ussuriensis, A. c. koreana, A. c. japonica Radoszkowski, 1887, A. c. cerana, and A. c. indica Fabricius, 1798. The method of cluster analysis of the sequences of mtDNA and the gene VG of nDNA showed the separation of bees into two groups, including the southern subspecies A. c. indica and northern subspecies A. c. ussuriensis, A. c. koreana, A. c. japonica, and A. c. cerana. Based on genetic divergence, it was shown that the subspecies A. c. ussuriensis is genetically close to A. c. japonica, A. c. koreana and A. c. cerana than with a subspecies A. c. indica. Values of genetic divergence (0.80% - 8.00%) and Jukes-Cantor genetic distance (0.005 - 0.100) for mtDNA and gene VG of nDNA between A. subspecies c. ussuriensis, A. c. koreana, A. c. japonica, A. c. cerana, A. c. indica are within intraspecies differences between insect subspecies. The estimated time of origin of A. cerana subspecies was rated about 2–1 million years ago. |
265. Ilyasov, R.A., Lee, M.-L., Yunusbaev, U., Nikolenko, A., Kwon, H.-W., 2020. Estimation of C-derived introgression into A. m. mellifera colonies in the Russian Urals using microsatellite genotyping. Genes & Genomics, 42. 1-10. DOI: 10.1007/s13258-020-00966-0.
Ilyasov, R.A., Lee, M.-L., Yunusbaev, U., Nikolenko, A., Kwon, H.-W., 2020. Estimation of C-derived introgression into A. m. mellifera colonies in the Russian Urals using microsatellite genotyping. Genes & Genomics, 42. 1-10. DOI: 10.1007/s13258-020-00966-0.
Abstract.
Marker-assisted selection is well established in animal breeding method of selecting individuals with desirable traits in a breeding scheme based on DNA molecular marker patterns. Genetic diversity and C-derived admixture into local purebred gene pool of A. m. mellifera colonies was assessed using polymorphism of nine microsatellite loci in order to provide further marker-assisted selection of desired honey bee colonies. The genetic diversity and the level of C-derived introgression into A. m. mellifera colonies in the Shulgan-Tash Nature Reserve (Russia) was assessed based on nine microsatellite loci (ap243, 4a110, A24, A8, A43, A113, A88, Ap049, A28), which were analized using the fragment analysis of the PCR products in Applied Biosystems 3130 DNA Analyzer. Phylogenetic relationship of colonies was evaluated using Neighbor-Joining methods with Cavalli-Sforza and Edwards genetic distance using the PHYLIP 3.68. The model-based Bayesian clustering algorithm implemented in STRUCTURE 2.3.3 was employed to infer membership and introgression proportions (Q-value). In the Shulgan-Tash Nature Reserve colonies of A. m. mellifera subdivided into four groups by level of C-derived introgression. Only five colonies of A. m. mellifera had C-derived introgression which varied from 0.5 to 2%. The genetic diversity in colonies of A. m. mellifera varied from 0.12 to 0.40. The Neighbor-Joining tree demonstrates the genetic relationship of A. m. mellifera colonies, which subdivided into three groups with different levels of C-derived introgression. Group 1 combined five honey bee colonies Bort_1, Bort_2, Bort_3, Baisalyan_1, and Kush_7 with a fraction of introgression close to 0.000 and genetic diversity from 0.20 to 0.25. The results showed the excellence of nine microsatellite loci genotyping in estimation of genetic diversity, distinguishing the two European evolutionary lineages M and C and estimating C-derived introgression. These genetic parameters can be applied further to perform the marker-assisted selection of purebred dark European honey bees. |
264. Ilyasov, R. A., Han, G. Y., Lee, M. L., Kim, K. W., Proshchalykin, M. Y., Lelej, A. S., Takahashi, J., & Kwon, H. W. (2019). Phylogenetic relationships of Russian Far-East Apis cerana with other north Asian populations. Journal of Apicultural Science, 63(2), 297–322. https://doi.org/10.2478/JAS-2019-0024
Ilyasov, R. A., Han, G. Y., Lee, M. L., Kim, K. W., Proshchalykin, M. Y., Lelej, A. S., Takahashi, J., & Kwon, H. W. (2019). Phylogenetic relationships of Russian Far-East Apis cerana with other north Asian populations. Journal of Apicultural Science, 63(2), 297–322. https://doi.org/10.2478/JAS-2019-0024
Abstract. Apis cerana Fabricius, 1793 is the eastern honeybee species distributed throughout Asia from the tropical climate in the southern part to the temperate climate in the northern part. We sequenced and annotated the complete mitochondrial DNA (mtDNA) of A. cerana from Vladivostok, Primorsky Krai of the Russian Far East and uploaded it to the database GenBank (AP018450). MtDNA sequence has 15,919 bp length, AT-content 84{\%} and GC-content 16{\%} and contains 22 tRNA genes, 13 protein-coding genes, two ribosomal RNA genes, one AT-rich region and four non-coding intergenic regions (NC1-4). All proteincoding genes start with ATT and ATG codons, except for ATC, the start codon of the ATP8 gene, which and stop with the common stop codons TAA and TAG. A comparative analysis of complete mtDNA of A. cerana from China, Indonesia, Korea, Malaysia, Russia, Taiwan, Thailand, Vietnam, and Japan found that the Russian Far East Apis cerana differed from others on the subspecies level. Based on the comparative analysis of complete mtDNA ({\~{}}16,000 bp), nuclear DNA (nDNA) gene Vitellogenin (VG) ({\~{}}4,100 bp) and morphological measurements (six parameters), we assumed that the Russian Far-East A. cerana can be a distinct northern Asia population and can be described as a separate unique subspecies of A. c. ussuriensis subsp. nov. A. c. koreana subsp. nov. is also validated and described as a new subspecies. |
263. Dar, S.A., Dukku, U.H., Ilyasov, R.A., Kandemir, I., Lee, M.L., Özkan Koca, A. 2019. Chapter 4. The classic taxonomy of Asian and European honey bees. 107-137 pp. In: R.A. Ilyasov and H.W. Kwon. [eds.]. Phylogenetics of Bees. CRC Press, Taylor and Francis Group, Boca Raton, London, New-York, USA. 290 pp. ISBN 9781138504233.
Dar, S.A., Dukku, U.H., Ilyasov, R.A., Kandemir, I., Lee, M.L., Özkan Koca, A. 2019. Chapter 4. The classic taxonomy of Asian and European honey bees. 107-137 pp. In: R.A. Ilyasov and H.W. Kwon. [eds.]. Phylogenetics of Bees. CRC Press, Taylor and Francis Group, Boca Raton, London, New-York, USA. 290 pp. ISBN 9781138504233.
Abstract. Honey bees of the genus Apis, belonging to the family Apidae and the superfamily Apoidea in the order of insects Hymenoptera. The number of Apis species and their identification methods are discussed. According to different authors, the number of species of the genus varied from 6 to 24. While Apis mellifera inhabits West Asia, Africa and Europe, the ranges of all other species, including Apis cerana, are limited to Asia. A. mellifera and A. cerana are two species widely used in agriculture for the pollination, the production of honey and other products. They have adapted to wide climatic conditions. Intraspecific taxonomy for both species is incomplete and contradictory. In this review, all available studies of A. mellifera and A. cerana are analyzed to ordering the modern taxonomy of honey bees. We found that there are 27 subspecies for A. mellifera and 7 subspecies for A. cerana. However, these data are not ultimate, since some subspecies of A. mellifera and A. cerana remain unexplored. |
262. Adjlane N., Badmazhapova E., Berezin A., Borodachev A., Brandorf A., Dar S. A., Dukku U.H., Eskov E., Gajda A., Gregorc A., Gulov A., Gushchina E., Hatjina F., Ilyasov R.A., Kandemir I., Kireeva T., Konusova O., Kucher A., Kwon H.W., Lee M.-l, Mitrofanov D., Ostroverkhova N., Özkan-Koca A., Pogorelov Y., Raffiudin R., Requier F., Rodrigues M., Seeley T.D., Yartsev V. (2020) Phylogenetics of bees. Editors: Ilyasov R.A., Kwon H.W. Boca Raton, London, New-York: CRC Press Taylor & Francis Group. 290 pp. (12 Color & 55 B/W Illustrations). ISBN 9781138504233.
Adjlane N., Badmazhapova E., Berezin A., Borodachev A., Brandorf A., Dar S. A., Dukku U.H., Eskov E., Gajda A., Gregorc A., Gulov A., Gushchina E., Hatjina F., Ilyasov R.A., Kandemir I., Kireeva T., Konusova O., Kucher A., Kwon H.W., Lee M.-l, Mitrofanov D., Ostroverkhova N., Özkan-Koca A., Pogorelov Y., Raffiudin R., Requier F., Rodrigues M., Seeley T.D., Yartsev V. (2020) Phylogenetics of bees. Editors: Ilyasov R.A., Kwon H.W. Boca Raton, London, New-York: CRC Press Taylor & Francis Group. 290 pp. (12 Color & 55 B/W Illustrations). ISBN 9781138504233.
Abstract. Bees are flying insects of the order Hymenoptera closely related to wasps and ants. The ancestors of bees are assumed to be predatory wasps, which switched to pollen consumption. Further, bees co-evolved with flowering plants and divided into several species according to climatic conditions. Widely known bees are western bees Apis mellifera, and eastern bees Apis cerana. This book sheds light on features of evolution, phylogenesis, speciation, adaptation to environment, and taxonomy of bees. It will be of particular relevance to evolutionists, geneticists, taxonomists, ecologists, population geneticist, and breeders. In this book “Phylogenetics of bees”, authors from different countries of the world have reviewed and summarized published research on the origin and evolution of colony in Apidae (Chapter 1), on phylogenies of Asian honey bees (Chapter 2), on the origin of the European bees and their intraspecific biodiversity (Chapter 3), on the classic taxonomy of Asian and European bees (Chapter 4), the genetic diversity of honey bee A. mellifera in Siberia (Chapter 5), on the current drivers of taxonomic biodiversity loss in Asian and European bees (Chapter 6), on the loss of taxonomic biodiversity of honey bees A. mellifera and A. cerana in Russia (Chapter 7), on the breeding of better and healthy honey bees as the only way to save the native biodiversity (Chapter 8), on the threats and importance of honey bee populations that spread beyond their native range, the case study of Latin America (Chapter 9), and on the history of honey bees in North America (Chapter 10). |
261. Lim, S., Yunusbaev, U. B., Ilyasov, R. A., Lee, H. S., & Kwon, H. W. (2020). Abdominal contact of fluvalinate induces olfactory deficit in Apis mellifera. Pesticide Biochemistry and Physiology, 164(1), 1–7. https://doi.org/10.1016/j.pestbp.2020.02.005
Lim, S., Yunusbaev, U. B., Ilyasov, R. A., Lee, H. S., & Kwon, H. W. (2020). Abdominal contact of fluvalinate induces olfactory deficit in Apis mellifera. Pesticide Biochemistry and Physiology, 164(1), 1–7. https://doi.org/10.1016/j.pestbp.2020.02.005
Abstract. τ–Fluvalinate (fluvalinate) is a highly selective pyrethroid insecticide compound used for controlling ectoparasitic mites that cause major damages in honey bee colonies. Although honey bees have resistance and low toxicity to this xenobiotic chemical, little is known about the effects of this chemical on sensory modulation and behaviors in honey bees. Here we addressed the effect on olfactory cognition at the behavioral, molecular, and neurophysiological levels. First, we found that topical application of fluvalinate to honeybee abdomen elicited somewhat severe toxicity to honey bees. Furthermore, honeybees treated with sublethal doses of fluvalinate showed a significant decrease in olfactory responses. At the molecular level, there was no change in gene expression levels of odorant receptor co-receptor (Orco), which is important for electrical conductivity induced by odorant binding in insects. Rather, small neuropeptide F (sNPF) signaling pathway was involved in olfactory fluctuation after treatment of fluvalinate. This indicates that olfactory deficits by abdominal contact of fluvalinate may stem from various internal molecular pathways in honey bees. |
260. Son J.D., Lim S.H., Han G.Y., Kim D.I., Yunusbaev U.B., Ilyasov R.A., Kwon H.W. Application of ICT based Dual Infrared Sensors for efficient honey bee monitoring // Proceedings of Spring International Conference of Korean Society of Applied Entomology, 24-26 April 2019. South Korea, Cheongju: Korean Society of Applied Entomology KSAE. P. 98.
Abstract.
Son J.D., Lim S.H., Han G.Y., Kim D.I., Yunusbaev U.B., Ilyasov R.A., Kwon H.W. Application of ICT based Dual Infrared Sensors for efficient honey bee monitoring // Proceedings of Spring International Conference of Korean Society of Applied Entomology, 24-26 April 2019. South Korea, Cheongju: Korean Society of Applied Entomology KSAE. P. 98.
Honey bees are affected by a variety of factors, so they have to be thoroughly managed according to their lifestyle. The activity of the honey bee foragers represent an important parameter of the hive state. Here, the real-time and automatic monitoring system using dual infrared sensors was applied for counting the foraging activity of honey bees based on ICT. According to this study, this system is very accurate with a relative error of 3.98% / 4.43% compared to manual counting through video analysis. This system showed the scalability of the system through the internal and external temperature sensors connected through the main board and BLE module. Furthermore, the data measured through this system for one month were analyzed, the monthly average foraging activity and the number of lost foragers were measured (1.88% of outgoing bees), and at the same time, the foraging patterns according to the changes of temperature and time were analyzed This study suggests that the development of apicultural, scientific and educational materials with more powerful real-time monitoring tools through expansion of a complex monitoring system and big data accumulation. |
259. Han G.Y., Lim S.H., Lee S.J., Ilyasov R.A., Yunusbaev U.B., Kwon H.W. Nutrition sensor regulates neuropeptide in the hypopharyngeal gland of honeybee // Proceedings of the 8th International Symposium on Molecular Insect Science (MOLI) 07-10 July 2019. Spain, Barcelona: Elsevier. P. 93.
Abstract.
Han G.Y., Lim S.H., Lee S.J., Ilyasov R.A., Yunusbaev U.B., Kwon H.W. Nutrition sensor regulates neuropeptide in the hypopharyngeal gland of honeybee // Proceedings of the 8th International Symposium on Molecular Insect Science (MOLI) 07-10 July 2019. Spain, Barcelona: Elsevier. P. 93.
In honeybees, nutrient sensors affect the ability to perceive chemosensory, change behavior, social behavior and labor division. Signals detected by nutrition sensors are affected by neuropeptides during sensory communication(Nassel et al., 2019). Currently, 35 neuropeptides are identified in honeybee but some of them did not defined yet (Yeoh et al., 2017). Royal jelly, which is given to larvae from housework nursing bees is important in terms of protein supply. These neuropeptides may have siginificatnt roles in developing tissues and social behaviors in honey bees. Here we identified one of the gustatory receptors tha showed differential expression patterns during caste development in honeybees. Thus, we here delved into the potential interaction of this Gr with neuropeptides using differentially Expressed Gene (DEG) analysis approach in hypopharyngeal grand where honeybees produce royal jelly. DEG analysis shows 7 neuropeptides are down regulated and 13 neuropeptides are up regulated in honey bees. Especially, insulin-like peptidel (ILP1), ILP2, which play a role for insulin-signaling pathway were down regulated. Our study indicates that chemosensory receptor not only detect nutrient in peripheral organ such as proboscis and antennae, but this also is likely involved in growth and development with neuropeptides. Key words: Gustatory receptor, Hypopharyngeal gland, RNA interference, DEG analysis, Insulin signaling pathway. RNA interference data shows us that AmGr-X is essential for the survival and growth of bees. According to DEG & GO analysis, AmGr-X knockdown can affect a variety of factors such as neuropeptides and metabolic processes, etc. |
258. Noh G.R., Kim D.I., Woo S.H., Ilyasov R.A., Kwon H.W. Hard tick (Ixodida: Ixodidae) catching by 3 kinds of attractant in Korea // Proceedings of the Government-wide R and D Fund project for infectious disease research (GFID) International Symposium SFTS Virus Infection and Control 17 October 2019. Korea, Seoul: Government-wide R and D Fund project for infectious disease research (GFID). P. 281.
Abstract.
Noh G.R., Kim D.I., Woo S.H., Ilyasov R.A., Kwon H.W. Hard tick (Ixodida: Ixodidae) catching by 3 kinds of attractant in Korea // Proceedings of the Government-wide R and D Fund project for infectious disease research (GFID) International Symposium SFTS Virus Infection and Control 17 October 2019. Korea, Seoul: Government-wide R and D Fund project for infectious disease research (GFID). P. 281.
Hard ticks (Ixodida: Ixodidae) transmit many important infectious H diseases such as Lyme disease, SFTS, and Tick-borne encephalitis. Even though mosquitoes are considered most serious disease vectors to humans and animals, hard ticks tend to flourish in many areas in the world and considered as the second most important disease vectors to humans and animals (Wikel, 2018). For surveillance to monitor hard ticks, they can be collected by a flagging method and tick-specific bait traps in Korea among which tick bait traps need attractants. Since only dry ice (CO ) is used to 2 attract hard ticks currenly, real population in a given area is vague so far. Thus, in this experiment, we used different kinds of attractant to compare catch rates in addition to CO , such as mammalian odorants including nonanal, 1-octen-3- 2 ol, fatty acids, which are commercially used in BG trap and Chigger mite trap (Steullet & Guerin, 1994; Soaresa & Borges, 2012).
1. Dominant species of hard ticks collected in this study was Haemaphysalis spp. because most collected hard tick were reported as Haemaphysalis spp. in Korea (Noh et al., 2018; Song et al., 2017).
2. Dry ice (CO ) and attractants used in BG trap were significantly 2 strong in attracting hard ticks, but attractants used in Chigger mite trap were not able to attract hard ticks.
3. Among species and stages of ticks, nymphs of Haemaphysalis longicornis were mostly attracted to tick bait traps. Among any stages and species collected in this study, hard ticks were shown best tendency of attractions.
4. Many hard tick species in America and Europe showed strong attraction to mammalian odorants (Steullet & Guerin, 1994; Yoder et al., 1998; Soaresa & Borges, 2012; Carr & Roe, 2016). However, our study showed H. longicornis ticks showed strong attraction behaviors.
5. Hard ticks in Korea were also strongly attracted to mammalian odorants. Our study demonstrated that mammalian odorants with dry ice (CO2) used in tick bait traps in downstream of wind condition showed 2 best scores of collection, compared to the usage of only dry ice. |
257. Lim S.H., Jung J.W., Lee H.S., Han G.Y., Ilyasov R.A., Kwon H.W. Discovering the umami receptor in the Western honey bee, Apis mellifera // Proceedings of the 8th International Symposium on Molecular Insect Science (MOLI) 07-10 July 2019. Spain, Barcelona: Elsevier. P. 81.
Abstract.
Lim S.H., Jung J.W., Lee H.S., Han G.Y., Ilyasov R.A., Kwon H.W. Discovering the umami receptor in the Western honey bee, Apis mellifera // Proceedings of the 8th International Symposium on Molecular Insect Science (MOLI) 07-10 July 2019. Spain, Barcelona: Elsevier. P. 81.
Taste is responsible for choosing profitable food sources and for nest mate recognition in honeybees. Taste detection for food sources occurs within cuticular hairs located on the antennae, on the mouthparts, and on the tarsi of the forelegs. Among food sources, umami taste perception indicates the presence of amino acids, which are essential nutrients. Although the physiology of umami perception has been described in mammals, how insects detect amino acids remains unknown. We functionally characterized a gustatory receptor responding to L-amino acids in the western honey bee, Apis mellifera. Using a calcium-imaging assay and two-voltage clamp recording, we found that one of the honey bee’s gustatory receptors, AmGr10, functions as a broadly tuned amino acid receptor responding to glutamate, aspartate, asparagine, arginine, lysine, and glutamine, but not to other sweet or bitter compounds. Furthermore, the sensitivity of AmGr10 to these L-amino acids was dramatically enhanced by inosine-5’-monophosphate (IMP). Contact sensory hairs in the mouthpart of the honey bee responded strongly to glutamate and aspartate, which house gustatory receptor neurons expressing AmGr10. This functional organization of the umami receptor of the honey bee strongly indicates the correlation of internal and external sensing of amino acids. Interestingly, AmGr10 protein is highly conserved among hymenoptera but not other insects, implying unique functions in social insects. |
256. Kim D.I., Lim S.H., Noh G.R., Han G.Y., Ilyasov R.A., Kwon H.W. Olfactory receptors essential for the blood-feeding process of the major disease vector, Aedes aegypti // Proceedings of the 8th International Symposium on Molecular Insect Science (MOLI) 07-10 July 2019. Spain, Barcelona: Elsevier. P. 75.
Abstract.
Kim D.I., Lim S.H., Noh G.R., Han G.Y., Ilyasov R.A., Kwon H.W. Olfactory receptors essential for the blood-feeding process of the major disease vector, Aedes aegypti // Proceedings of the 8th International Symposium on Molecular Insect Science (MOLI) 07-10 July 2019. Spain, Barcelona: Elsevier. P. 75.
The yellow fever mosquito, Aedes aegypti (Ae. aegypti) is a major disease vector for dengue virus, Zika virus, yellow fever and chikungunya. One of the poorly understood aspects of mosquito blood-feeding behaviours is how they target an optimal site in order to penetrate the skin and blood vessels without alerting the host animal. Here we provide new findings that the piercing-sucking stylet of Ae. aegypti is an essential apparatus for the final stage in blood feeding behaviour. Indeed, the stylet possesses olfactory receptor neurons that express two conventional olfactory receptors of Ae. aegypti (AaOrs), AaOr8 and AaOr49, together with the olfactory co-receptor (AaOrco). In vitrocalcium imaging using transfected cell lines demonstrated that AaOr8 and AaOr49 were activated by volatile compounds present in blood. Gene expression inhibition of these Ors interferes with blood-feeding behaviours. In silico protein modeling and mutaganasis also demonstrated structural interactions between these Ors and ligands. Taken together, we identified olfactory receptor neurons in the stylet involved in mosquito blood feeding behaviors, which in turn indicates that olfactory perception in the stylet is necessary and sufficient for mosquitoes to find host blood in order to rapidly acquire blood meals from a host animal. |
255. Kwon H.W., Han G.Y., Kim D.I., Noh G.R., Ilyasov R.A. The Negative Impact of High Fat Diets (HFD) Induced Stress in Drosophila melanogaster // Proceedings of the 8th International Symposium on Molecular Insect Science (MOLI) 07-10 July 2019. Spain, Barcelona: Elsevier. P. 64.
Abstract.
Kwon H.W., Han G.Y., Kim D.I., Noh G.R., Ilyasov R.A. The Negative Impact of High Fat Diets (HFD) Induced Stress in Drosophila melanogaster // Proceedings of the 8th International Symposium on Molecular Insect Science (MOLI) 07-10 July 2019. Spain, Barcelona: Elsevier. P. 64.
High-fat diet (HFD) often causes obesity, heart disease, cancer and it has detrimental effects on the sensory system. In particular, sensory-mediated responses are crucial for maintaining energy balance, as they are involved in a metabolic regulation; however, little is known about the impact of HFD-induced stress on sensory system. We have used a Drosophila melanogaster model to gain insight on how HFD- induced stress affects physiological, behavioral, and transcriptional changes related with olfactory and nutrient-related signaling. We demonstrated that lifespan and locomotor activiy in HFD-treated flies decreased and that olfactory sensitivity and behavioral responses to odorants were changed. Olfactory sensitivity to eight of ten odorants after 14 days on HFD treatment were reduced, while behavioral attraction was increased to benzaldehyde and 1-hexanol in flies that were treated with HFD for 7 days. This behavioral and physiological modification by HFD treatment was accompanied by a significant decrease in DmOrco gene expression in a peripheral olfactory organ, suggesting that is could be involved in the action of metabolic and sensory signal. Gene expression profiles of antennae showed significant differences on the olfactory receptors, odorant-binding proteins, and insulin signaling. Our results suggested that olfactory sensitivity and behavioral responses to HFD-induced stress are mediated through olfactory and nutrient-related signaling pathways. |
254. Ilyasov R.A., Lee M.L., Kim K.W., Han G.Y., Lim S.H., Kim D.I., Noh G.R., Proshchalykin M.Y., Lelej A.S., Takahashi J.I., Kwon H.W. Apis cerana subspecies in North-East Asia // Proceedings of Fall International Conference of Korean Society of Applied Entomology, 24-25 October 2019. South Korea, Pyeongchang-gun: Korean Society of Applied Entomology KSAE. 2019. P. 35.
Abstract.
Ilyasov R.A., Lee M.L., Kim K.W., Han G.Y., Lim S.H., Kim D.I., Noh G.R., Proshchalykin M.Y., Lelej A.S., Takahashi J.I., Kwon H.W. Apis cerana subspecies in North-East Asia // Proceedings of Fall International Conference of Korean Society of Applied Entomology, 24-25 October 2019. South Korea, Pyeongchang-gun: Korean Society of Applied Entomology KSAE. 2019. P. 35.
The complete mitochondrial DNA (mtDNA) of A. cerana from Vladivostok, Primorsky Krai of the Russian Far East have been sequenced, annotated and uploaded to database Genbank (A P018450). MtDNA sequence has 15,919 bp length, AT-content 84% and GC-content 16% and c ontains 22 tRNA genes, 13 protein-coding genes, two ribosomal RNA genes, one AT-rich regio n and four non-coding intergenic regions (NC1-4). All protein-coding genes are started by ATT and ATG codons, excepting the start codon of ATP8 gene, which ATC, and are stopped by t he common stop codons TAA and TAG. A comparative analysis of complete mtDNA of A. cer ana from China, Indonesia, Korea, Malaysia, Russia, Taiwan, Thailand, Vietnam, and Japan fou nd that the Russian Far East Apis cerana differ from others on the subspecies level. Based on comparative analysis of complete mtDNA (~16,000 bp), nuclear DNA (nDNA) gene Vitellogeni n (VG) (~4,100 bp) and morphological measurements (six parameters) we assumed that Russian Far-East A. cerana can be a distinct northern Asia population, which can be assigned as a sep arate unique subspecies of Apis cerana ussuriensis subsp. nov. Apis cerana koreana subsp. nov. is also validated and described as a new subspecies. |
253. Lim S.H., Han G.Y., Lee S.J., Ilyasov R.A., Kwon H.W. How does honey bee detect amino acid nutrients: Umami taste sensor in the western honey bee, Apis mellifera // Proceedings of Fall International Conference of Korean Society of Applied Entomology, 24-25 October 2019. South Korea, Pyeongchang-gun: Korean Society of Applied Entomology KSAE. P. 27.
Abstract.
Lim S.H., Han G.Y., Lee S.J., Ilyasov R.A., Kwon H.W. How does honey bee detect amino acid nutrients: Umami taste sensor in the western honey bee, Apis mellifera // Proceedings of Fall International Conference of Korean Society of Applied Entomology, 24-25 October 2019. South Korea, Pyeongchang-gun: Korean Society of Applied Entomology KSAE. P. 27.
Department of Life Sciences & Convergence Research Center for Insect Vectors, Incheon National University In honey bees, taste is responsible for choosing profitable food sources and for nest mate recognition. Taste detection for food sources occurs within cuticular hairs located on the antennae, on the mouthparts, and on the tarsi of the forelegs. Among food sources, umami taste perception indicates the presence of amino acids, which are essential nutrients along with sugar and fat. Although the physiology of umami perception has been described in mammals, how insects detect amino acids remains unclear. Here, we fonctionally characterized a gustatory receptor responding to L-amino acids in the western honey bee, Apis mellifera. Using a calcium-imaging assay and two-voltage clamp recording, we found that one of the honey bee s gustatory receptors, AmGrlO, functions as a broadly tuned amino acid receptor responding to glutamate, aspartate, asparagine, arginine, lysine, and glutamine, but not to other sweet or bitter compounds. Furthermore, the sensitivity of AmGrlO to these L-amino acids was dramatically enhanced by inosine-5'-monophosphate (IMP). Contact sensory hairs in the mouthpart of the honey bee responded strongly to glutamate and aspartate, which house gustatory receptor neurons expressing AmGrlO. This functional organization of the umami receptor of the honey bee strongly indicates the correlation of internal and external sensing of amino acids. Surprisingly, AmGrlO protein is highly conserved among hymenoptera but not other insects, implying unique functions in social insects. |
252. Han G.Y., Lim S.H., Lee S.J., Ilyasov R.A., Yunusbaev U.B., Kwon H.W. Identification and implication of neuropeptides expressed in honeybee, Apis mellifera and Apis cerana // Proceedings of Fall International Conference of Korean Society of Applied Entomology, 24-25 October 2019. South Korea, Pyeongchang-gun: Korean Society of Applied Entomology KSAE. P. 48.
Abstract.
Han G.Y., Lim S.H., Lee S.J., Ilyasov R.A., Yunusbaev U.B., Kwon H.W. Identification and implication of neuropeptides expressed in honeybee, Apis mellifera and Apis cerana // Proceedings of Fall International Conference of Korean Society of Applied Entomology, 24-25 October 2019. South Korea, Pyeongchang-gun: Korean Society of Applied Entomology KSAE. P. 48.
In honeybees, nutrient sensors affect the ability to perceive chemosensory, change behavior, social behavior and labor division. Signals detected by nutrition sensors are affected by neuropeptides during sensory communication. Currently, 35 neuropeptides are identified in honeybee but some of them did not defined yet. Royal jelly, which is given to larvae from housework nursing bees is important in terms of protein supply. These neuropeptides may have siginificatnt roles in developing tissues and social behaviors in honey bees. Here we identified one of the gustatory receptors tha showed differential expression patterns during caste development in honeybees. Thus, we here delved into the potential interaction of this Gr with neuropeptides using differentially Expressed Gene (DEG) analysis approach in hypopharyngeal grand where honeybees produce royal jelly. DEG analysis shows 7 neuropeptides are down regulated and 13 neuropeptides are up regulated in honey bees. Especially, insulin-like peptidel (ILP1), ILP2. which play a role for insulin-signaling pathway were down regulated. Our study indicates that chemosensory receptor not only detect nutrient in peripheral organ such as proboscis and antennae, but this also is likely involved in growth and development with neuropeptides. |
251. Han G.Y., Ilyasov R.A., Lee M.L., Kwon H.W. Phylogenetic relationships of Russian far-east Apis cerana with other North Asian populations // Proceedings of Fall International Conference of Korean Society of Applied Entomology, 24-25 October 2019. South Korea, Pyeongchang-gun: Korean Society of Applied Entomology KSAE. P. 43.
Abstract.
Han G.Y., Ilyasov R.A., Lee M.L., Kwon H.W. Phylogenetic relationships of Russian far-east Apis cerana with other North Asian populations // Proceedings of Fall International Conference of Korean Society of Applied Entomology, 24-25 October 2019. South Korea, Pyeongchang-gun: Korean Society of Applied Entomology KSAE. P. 43.
Apis cerana Fabricius, 1793 is the eastern honeybee species distributed throughout Asia from the tropical climate in the southern part to the temperate climate in the northern part. We sequenced and annotated the complete mitochondrial DNA (mtDNA) of A. cerana from Vladivostok, Primorsky Krai of the Russian Far East and uploaded it to the database GenBank (AP018450). MtDNA sequence has 15,919 bp length, AT-content 84% and GC-content 16% and contains 22 tRNA genes, 13 protein- coding genes, two ribosomal RNA genes, one AT-rich region and four non-coding intergenic regions (NC1-4). All protein-coding genes start with ATT and ATG codons, except for ATC, the start codon of the ATP8 gene, which and stop with the common stop codons TAA and TAG. A comparative analysis of complete mtDNA of A. cerana from China, Indonesia, Korea, Malaysia, Russia, Taiwan, Thailand, Vietnam, and Japan found that the Russian Far East Apis cerana differed from others on the subspecies level. Based on the comparative analysis of complete mtDNA (~16,000 bp), nuclear DNA (nDNA) gene Vitellogenin (VG) (~4,100 bp) and morphological measurements (six parameters), we assumed that the Russian Far-East A. cerana can be a distinct northern Asia population and can be described as a separate unique subspecies of Apis cerana ussuriensis subsp. nov. Apis cerana koreana subsp. nov. is also validated and described as a new subspecies. |
250. Дунин И.М., Новиков А.А., Калашникова Л.А., Калашников А.Е., Гладырь Е.А., Бурмистрова Л.А., Бородачев А.В., Николенко А.Г., Ильясов Р.А., Туктаров В.Р., Удина И.Г. Методические рекомендации: Стандартные методы генетической идентификации, определения достоверности происхождения и бонитировки пчелиных семей. Лесные Поляны, Московская область: ВНИИплем. 2019. 77 с. ISBN 978-5-87958-383-0. (Dunin I.M., Novikov A.A., Kalashnikova L.A., Kalashnikov A.E., Gladyr E.A., Burmistrov L.A., Borodachev A.V., Nikolenko A.G., Ilyasov R.A., Tuktarov V.R., Udina I.G. Guidelines: The standard methods of genetic identification, determining the validity of origin and appraisal of honey bee colonies (translation). Lesnye Polyany, The Moscow region: VNIIplem. 2019. 77 pp. ISBN 978-5-87958-383-0.)
Дунин И.М., Новиков А.А., Калашникова Л.А., Калашников А.Е., Гладырь Е.А., Бурмистрова Л.А., Бородачев А.В., Николенко А.Г., Ильясов Р.А., Туктаров В.Р., Удина И.Г. Методические рекомендации: Стандартные методы генетической идентификации, определения достоверности происхождения и бонитировки пчелиных семей. Лесные Поляны, Московская область: ВНИИплем. 2019. 77 с. ISBN 978-5-87958-383-0. (Dunin I.M., Novikov A.A., Kalashnikova L.A., Kalashnikov A.E., Gladyr E.A., Burmistrov L.A., Borodachev A.V., Nikolenko A.G., Ilyasov R.A., Tuktarov V.R., Udina I.G. Guidelines: The standard methods of genetic identification, determining the validity of origin and appraisal of honey bee colonies (translation). Lesnye Polyany, The Moscow region: VNIIplem. 2019. 77 pp. ISBN 978-5-87958-383-0.)Abstract. Методические рекомендации: Стандартные методы генетической идентификации, определения достоверности происхождения и бонитировки пчелиных семей. Методические рекомендации рассчитаны на специалистов лабораторий ветеринарии, молекулярной генетики, иммунологии, генетики и разведения в пчеловодстве и работников племобъединений Российской Федерации. Рассмотрены и одобрены на учёном совете ВНИИплем (протокол №3 от 29 июня 2018 г.).
Guidelines: The standard methods of genetic identification, determining the validity of origin and appraisal of honey bee colonies. Guidelines are designed for specialist veterinary laboratory, molecular genetics, immunology, genetics and breeding in beekeeping and workers plemobedineny Russian Federation. Reviewed and approved at the Scientific Council VNIIplem (№3 Minutes of June 29, 2018). |
249. Ilyasov R.A., Lee M.-l., Kim K.W., Han G.Y., Lim S.H., Kim D.I., Noh G.R., Proshchalykin M.Yu., Lelej A.S. , Takahashi J.-i., Kwon H.W. Features of the russian far east population of Apis cerana. Proceedings of IV Euroasian Symposium on Hymenoptera. Vladivostok: FSC Biodiversity FEB RAS, 9–15 September 2019. P. 11-12. DOI: 10.25221/hym4. (Ильясов Р.А., Ли М.Л., Ким К.В., Хан Г.Ю., Лим С.Х., Ким Д.И., Но Г.Р., Прощалыкин М.Ю., Лелей А.С., Такахаши Д.И., Квон Х.В. Особенности российской дальневосточной популяции Apis cerana. Материалы IV Евроазиатского симпозиума по перепончатокрылым насекомым. Владивосток: ФНЦ Биоразнообразия ДВО РАН, 9–15 сентября 2019. С. 11-12. DOI: 10.25221/hym4)
Ilyasov R.A., Lee M.-l., Kim K.W., Han G.Y., Lim S.H., Kim D.I., Noh G.R., Proshchalykin M.Yu., Lelej A.S. , Takahashi J.-i., Kwon H.W. Features of the russian far east population of Apis cerana. Proceedings of IV Euroasian Symposium on Hymenoptera. Vladivostok: FSC Biodiversity FEB RAS, 9–15 September 2019. P. 11-12. DOI: 10.25221/hym4. (Ильясов Р.А., Ли М.Л., Ким К.В., Хан Г.Ю., Лим С.Х., Ким Д.И., Но Г.Р., Прощалыкин М.Ю., Лелей А.С., Такахаши Д.И., Квон Х.В. Особенности российской дальневосточной популяции Apis cerana. Материалы IV Евроазиатского симпозиума по перепончатокрылым насекомым. Владивосток: ФНЦ Биоразнообразия ДВО РАН, 9–15 сентября 2019. С. 11-12. DOI: 10.25221/hym4) Abstract. Asian honeybee Apis cerana occurs across southern and south-eastern Asia up to Russia in northern Asia, and its natural distribution extends to Japan and stretches as far west as Afghanistan. Apis cerana occupies a large range with varied climatic conditions, from cool regions in higher latitudes and altitudes, to dry, semi-desert environments, as well as tropical climates. A. cerana has wide range of variation and adaptation and genetically, thus morphologically is subdivided into several ecotypes that differ in their biology, especially between northern and southern ecotypes (Koetz, 2013).
To identify genetic diversity of A. cerana a lot of studies employed an internal non-coding spacer NC2 between genes tRNA-Leu and COX2 of mitochondrial DNA (mtDNA) (Cornuet et al., 1991), a restriction enzyme analysis and direct sequencing the mitochondrial genes COX1, 12S and 16S rRNA genes of mtDNA (Kim et al., 2010). Although these markers possess appropriate merits (Oh et al., 2009), they were insufficient to uncover the genetic diversity, variability, and biogeographic history of A. cerana (Tan et al., 2007). The complete mtDNA can be a more effective and useful tool for the population genetic, and phylogeographic studies of A. cerana. In this article, we have analyzed the complete sequence of the mtDNA of A. cerana from the Russian Far East in comparison with other A. cerana populations to denominate the unique strain and uncover its phylogenetic relationships with other subspecies. In addition, the nuclear DNA (nDNA) gene Vitellogenin (VG) and morphometry study were used as supporting data. The phylogenetic uniqueness of A. cerana from the Russian Far East has been proved based on the three types of tests of the mitochondrial DNA (mtDNA), nuclear DNA (nDNA), and morphology.
The complete mitochondrial DNA (mtDNA) of A. cerana from Vladivostok, Primorsky Krai of the Russian Far East have been sequenced, annotated and uploaded to database Genbank (AP018450). MtDNA sequence has 15,919 bp length, AT-content 84% and GC-content 16% and contains 22 tRNA genes, 13 protein-coding genes, two ribosomal RNA genes, one AT-rich region and four non-coding intergenic regions (NC1-4). All protein-coding genes are started by ATT and ATG codons, excepting the start codon of ATP8 gene, which ATC, and are stopped by the common stop codons TAA and TAG. A comparative analysis of complete mtDNA of A. cerana from China, Indonesia, Korea, Malaysia, Russia, Taiwan, Thailand, Vietnam, and Japan found that the Russian Far East Apis cerana differ from others on the subspecies level. Based on comparative analysis of complete mtDNA (~16,000 bp), nuclear DNA (nDNA) gene Vitellogenin (VG) (~4,100 bp) and morphological measurements (six parameters) we assumed that Russian Far-East A. cerana can be a distinct northern Asia population, which can be assigned as a separate unique subspecies of Apis cerana ussuriensis subsp. nov. Apis cerana koreana subsp. nov. is also validated and described as a new subspecies (Ilyasov et al., 2018.
Due to the uniqueness of the Russian Far East A. cerana population, we assumed Russian Far East A. cerana population can be assigned as unique subspecies of Apis cerana ussuriensis subsp. nov. Apis cerana koreana subsp. nov. is validated and described as a new subspecies. Further in-depth studies have to prove this statement. The Russian Far East A. c. ussuriensis has unique marvelous properties like the ability to live in northern Asia.
This work was carried out with the support of the Cooperative Research Program for Agriculture Science and Technology Development (Project Numbers: PJ012285 and PJ012526) and supported from the postdoctoral fellowships from Incheon National University. The work of MYP and ASL was supported by the Russian Found of Basic Research (# 17-04-00259). We are grateful to Dr. Hisashi Okuyama for kindly providing data for helping our analysis. |
248. Ilyasov R. A., Park J., Takahashi J., Kwon H. W. Phylogenetic uniqueness of honeybee Apis cerana from the Korean peninsula inferred from the mitochondrial, nuclear, and morphological data. Journal of Apicultural Science. 2018. 62 (2). P. 189-214. DOI: 10.2478/JAS-2018-0018.
Ilyasov R. A., Park J., Takahashi J., Kwon H. W. Phylogenetic uniqueness of honeybee Apis cerana from the Korean peninsula inferred from the mitochondrial, nuclear, and morphological data. Journal of Apicultural Science. 2018. 62 (2). P. 189-214. DOI: 10.2478/JAS-2018-0018. Abstract. Apis cerana is an Eastern honeybee species distributed throughout Asia and closely related to the Western honeybee species Apis mellifera distributed across all of Africa, Europe and Western Asia, and subdivided into thirty confirmed subspecies. Currently, A. cerana is an endangered bee species in contrast to A. mellifera. We sequenced and annotated the complete mitochondrial genome of A. cerana from the Jeollanam-do province of South Korea and uploaded to the DDBJ/Genbank database(AP018431). MtDNA sequence is 15.925 bp long, has 84% AT-content and 16% GC-content and contains 22 tRNA genes, 13 protein-coding genes, two ribosomal RNA genes, one AT-rich region and four non-coding intergenic regions (NC1-4). All protein-coding genes are started by ATT and ATG codons, except the genes ATP8 and ND4, which started by ATC and ATA, respectively, and are stopped by the common codons TAA and TAG. A comparative analysis of the whole mtDNA sequences of A. cerana from Korea and Taiwan, A. c. cerana from China and A. c. japonica from Japan showed that the genetic divergence of the Korean A. cerana sample from subspecies A. c. cerana (2.57%) and A. c. japonica (2.58%) matched to the level of genetic divergence of mtDNA between animal subspecies (0.8-8%). Based on the comparative analysis of complete mtDNA (~16,000 bp), two nuclear gene VG and EF1α sequences (~8,000 bp) and morphological measurements (six parameters), we assumed that Korean A. cerana, Chinese A. c. cerana and Japanese A. c. japonica are different subspecies at an early stage of sub-speciation and could be called further as subspecies of Apis cerana koreana. |
247. Ilyasov R.A., Lee M.-l., Kim K.W., Han G.Y., Lim S.H., Kim D.I., Noh G.R., Proshchalykin M.Yu., Lelej A.S. , Takahashi J.-i., Kwon H.W. Apis cerana subspecies in North-East Asia. Materials of Fall International Conference of Korean Society of Applied Entomology. 24-25 October 2019. South Korea, Pyeongchang-gun: Korean Society of Applied Entomology KSAE. P. 35.
Ilyasov R.A., Lee M.-l., Kim K.W., Han G.Y., Lim S.H., Kim D.I., Noh G.R., Proshchalykin M.Yu., Lelej A.S. , Takahashi J.-i., Kwon H.W. Apis cerana subspecies in North-East Asia. Materials of Fall International Conference of Korean Society of Applied Entomology. 24-25 October 2019. South Korea, Pyeongchang-gun: Korean Society of Applied Entomology KSAE. P. 35. Abstract. The complete mitochondrial DNA (mtDNA) of A. cerana from Vladivostok, Primorsky Krai of the Russian Far East have been sequenced, annotated and uploaded to database Genbank (AP018450). MtDNA sequence has 15,919 bp length, AT-content 84% and GC-content 16% and contains 22 tRNA genes, 13 protein-coding genes, two ribosomal RNA genes, one AT-rich region and four non-coding intergenic regions (NC1-4). All protein-coding genes are started by ATT and ATG codons, excepting the start codon of ATP8 gene, which ATC, and are stopped by the common stop codons TAA and TAG. A comparative analysis of complete mtDNA of A. cerana from China, Indonesia, Korea, Malaysia, Russia, Taiwan, Thailand, Vietnam, and Japan found that the Russian Far East Apis cerana differ from others on the subspecies level. Based on comparative analysis of complete mtDNA (~16,000 bp), nuclear DNA (nDNA) gene Vitellogenin (VG) (~4,100 bp) and morphological measurements (six parameters) we assumed that Russian Far-East A. cerana can be a distinct northern Asia population, which can be assigned as a separate unique subspecies of Apis cerana ussuriensis subsp. nov. Apis cerana koreana subsp. nov. is also validated and described as a new subspecies. |
246. Lim S., Jung J., Yunusbaev U., Ilyasov, R., Kwon H. W. Characterization and its implication of a novel taste receptor detecting nutrients in the honey bee, Apis mellifera. Scientific Reports. 2019. 9 (1): 11620. DOI: 10.1038/s41598-019-53738-6.
Lim S., Jung J., Yunusbaev U., Ilyasov, R., Kwon H. W. Characterization and its implication of a novel taste receptor detecting nutrients in the honey bee, Apis mellifera. Scientific Reports. 2019. 9 (1): 11620. DOI: 10.1038/s41598-019-53738-6. Abstract. Umami taste perception indicates the presence of amino acids, which are essential nutrients. Although the physiology of umami perception has been described in mammals, how insects detect amino acids remains unknown except in Drosophila melanogaster. We functionally characterized a gustatory receptor responding to L-amino acids in the western honey bee, Apis mellifera. Using a calcium-imaging assay and two-voltage clamp recording, we found that one of the honey bee’s gustatory receptors, AmGr10, functions as a broadly tuned amino acid receptor responding to glutamate, aspartate, asparagine, arginine, lysine, and glutamine, but not to other sweet or bitter compounds. Furthermore, the sensitivity of AmGr10 to these L-amino acids was dramatically enhanced by purine ribonucleotides, like inosine-5′-monophosphate (IMP). Contact sensory hairs in the mouthpart of the honey bee responded strongly to glutamate and aspartate, which house gustatory receptor neurons expressing AmGr10. Interestingly, AmGr10 protein is highly conserved among hymenopterans but not other insects, implying unique functions in eusocial insects. |
245. Ilyasov R. A., Nikolenko A. G., Tuktarov V. R., Goto K., Takahashi J. I., Kwon H. W. Comparative analysis of mitochondrial genomes of the honey bee subspecies A. m. caucasica and A. m. carpathica and refinement of their evolutionary lineages. Journal of Apicultural Research. 2019. V. 58. No. 4. P. 567-579. DOI: 10.1080/00218839.2019.1622320.
Ilyasov R. A., Nikolenko A. G., Tuktarov V. R., Goto K., Takahashi J. I., Kwon H. W. Comparative analysis of mitochondrial genomes of the honey bee subspecies A. m. caucasica and A. m. carpathica and refinement of their evolutionary lineages. Journal of Apicultural Research. 2019. V. 58. No. 4. P. 567-579. DOI: 10.1080/00218839.2019.1622320. Abstract. The complete mitochondrial genome sequences of the honey bee subspecies Apis mellifera caucasica and Apis mellifera carpathica were analyzed for the first time. The length of the mitochondrial DNA (mtDNA) sequences of A. m. caucasica and A. m. carpathica are 16,341 and 16,336 bps, respectively. Both sequences contain 13 protein-coding genes, 22 transfer RNA genes, 2 ribosomal RNA genes, and 1 AT-rich region. The overall composition of the nucleotides in the mtDNA of A. m. caucasica/A. m. carpathica is as follows: A (43.2/43.3%), C (9.5/9.6%), G (5.6/5.5%), and T (41.6/41.6%). Most of the mtDNA genes of both subspecies (ND2, COX1, COX2, ATP8, ATP6, COX3, ND3, ND6, CYTB, and 14 tRNA genes) are located on the heavy strand, and less (ND1, ND4, ND4L, ND5, SrRNA, LrRNA, and 8 tRNA genes) are located on the light strand. Phylogenetic analysis based on the complete mtDNA showed that both subspecies A. m. caucasica and A. m. carpathica are representatives of the C lineage. Thirty-five unique markers (ND5/XbaI and 34 SNPs) were found which enable the differentiation of the honey bee subspecies A. m. caucasica and A. m. carpathica. These genetic markers can contribute to purebred beekeeping and will help to prevent hybridization between these endangered honey bee subspecies in Europe. |
244. Ilyasov R.A., Lee M.L., Nikolenko A.G., Takahashi J., Kwon H.W. Phylogenetic studies of Apis cerana honeybees of the Korean peninsula. P. 52-56. In: Apis mellifera mellifera L. into development strategies world of beekeeping / Ed. A.Z. Brandorf, M.M. Ivoilova. Kirov: Agricultural Research Institute of the North-East, 2019. 220 p. (Ильясов Р.А., Ли М.Л., Николенко А.Г., Такахаши Д., Квон Х.В. Филогенетические исследования пчел Apis cerana Корейского полуострова. С. 52-56. В книге: Среднерусская порода медоносных пчёл в стратегии развития мирового пчеловодства / ред. А.З. Брандорф, М.М. Ивойлова. Киров: ФАНЦ Северо-Востока, 2019. 220 с.).
Ilyasov R.A., Lee M.L., Nikolenko A.G., Takahashi J., Kwon H.W. Phylogenetic studies of Apis cerana honeybees of the Korean peninsula. P. 52-56. In: Apis mellifera mellifera L. into development strategies world of beekeeping / Ed. A.Z. Brandorf, M.M. Ivoilova. Kirov: Agricultural Research Institute of the North-East, 2019. 220 p. (Ильясов Р.А., Ли М.Л., Николенко А.Г., Такахаши Д., Квон Х.В. Филогенетические исследования пчел Apis cerana Корейского полуострова. С. 52-56. В книге: Среднерусская порода медоносных пчёл в стратегии развития мирового пчеловодства / ред. А.З. Брандорф, М.М. Ивойлова. Киров: ФАНЦ Северо-Востока, 2019. 220 с.). Abstract. We analyzed the complete mitochondrial genome of A. c. koreana from Jollanamdo province of South Korea and deposited into the Genbank (AP018431). Comparative analysis of the complete mtDNA sequences from A. cerana from Taiwan, Korea (A. c. koreana), China (A. c. cerana), and Japan (A. c. japonica) showed that genetic divergence A. c. koreana, A. c. cerana, and A. c. japonica corresponded to the level of genetic divergence of mtDNA between the subspecies of bees. Based on a comparative analysis of complete mtDNA (~ 16000 bp), we showed that A. c. koreana, A. c. cerana, and A. c. japonica are subspecies on the early divergence stage of Apis cerana.Аннотация. Проанализирован полный митохондриальный геном A. c. koreana из провинции Джолланамдо Южной Кореи и депонирован в генбанк Genbank (AP018431). Сравнительный анализ последовательностей полной мтДНК A. cerana из Тайваня, Кореи (A. c. koreana), Китая (A. c. cerana) и Японии (A. c. japonica) показал, что генетическое расхождение A. c. koreana, A. c. cerana и A. c. japonica соответствовало уровню генетической дивергенции мтДНК между подвидами пчел. На основании сравнительного анализа полной мтДНК (~ 16 000 п.н.) показано, что A. c. koreana, A. c. cerana и A. c. japonica – это подвиды Apis cerana на ранней стадии дивергенции. |
243. Ильясов Р.A., Дар С.А., Дукку У.Х., Кандемир И., Ли М.Л., Озкан Коса А., Николенко А.Г., Квон Х.В. Обзор современной таксономии азиатских и европейских пчел рода Apis // Биомика. 2019. Т.11(2). С. 212 – 241. DOI: 10.31301/2221-6197.bmcs.2019-21. (Ilyasov R.A., Dar S.A., Dukku U.H., Kandemir I., Lee M.L., Özkan Koca A., Nikolenko A.G., Kwon H.W. Review of the current taxonomy of Asian and European honey bees of the genus Apis. Biomics. 2019. V.11(2). P. 212 – 241. DOI: 10.31301/2221-6197.bmcs.2019-21 (In Russian)).
Ильясов Р.A., Дар С.А., Дукку У.Х., Кандемир И., Ли М.Л., Озкан Коса А., Николенко А.Г., Квон Х.В. Обзор современной таксономии азиатских и европейских пчел рода Apis // Биомика. 2019. Т.11(2). С. 212 – 241. DOI: 10.31301/2221-6197.bmcs.2019-21. (Ilyasov R.A., Dar S.A., Dukku U.H., Kandemir I., Lee M.L., Özkan Koca A., Nikolenko A.G., Kwon H.W. Review of the current taxonomy of Asian and European honey bees of the genus Apis. Biomics. 2019. V.11(2). P. 212 – 241. DOI: 10.31301/2221-6197.bmcs.2019-21 (In Russian)). Резюме. Медоносные пчелы рода Apis принадлежат к семейству Apidae и суперсемейству Apoidea в отряде насекомых Hymenoptera. Количество видов Apis и методы их идентификация всегда были предметом споров, где количество изменялось у разных авторов от 6 до 24. В то время как Apis mellifera населяет Западную Азию, Африку и Европу, ареалы всех других видов, включая Apis cerana, ограничены Азией. A. mellifera и A. cerana - два вида, широко используемые в сельском хозяйстве для опыления, производства меда и других продуктов. Они обладают широким ареалом и населяют места с климатом от резко континентального до тропического. Внутривидовая таксономия для обоих видов не завершена и противоречива. В этом обзоре проанализированы все доступные исследования A. mellifera и A. cerana с целью упорядочить современную таксономию медоносных пчел. Мы пересмотрели внутривидовую таксономию европейских и азиатских пчел и показали существование 27 подвидов для A. mellifera и 7 подвидов для A. cerana. Однако эти данные не являются окончательными, поскольку некоторые подвиды A. mellifera и A. cerana остаются еще неисследованными.
Resume. Honey bees of the genus Apis belong to the family Apidae and the superfamily Apoidea in the order of insects Hymenoptera. The number of Apis species and their identification methods are discussed. According to different authors, the number of species of the genus varied from 6 to 24. While Apis mellifera inhabits West Asia, Africa and Europe, the ranges of all other species, including Apis cerana, are limited to Asia. A. mellifera and A. cerana are two species widely used in agriculture for the pollination, the production of honey and other products. They have adapted to wide climatic conditions. Intraspecific taxonomy for both species is incomplete and contradictory. In this review, all available studies of A. mellifera and A. cerana are analyzed to ordering the modern taxonomy of honey bees. We found that there are 27 subspecies for A. mellifera and 7 subspecies for A. cerana. However, these data are not ultimate, since some subspecies of A. mellifera and A. cerana remain unexplored. |
242. Ильясов Р. А., Дар С. А., Дукку У. Х., Кандемир И., Ли М. Л., Озкан Коса А., Николенко А. Г., Квон Х. В. Современная таксономия пчел Apis mellifera and Apis cerana. Пчеловодство. 2019. 9: 15 - 19. (Ilyasov R. A., Dar S. A., Dukku U. H., Kandemir I., Lee M. L., Ozkan Koca A ., Nikolenko A. G., Kwon H. W. Current taxonomy of honey bees Apis mellifera and Apis cerana (translation). Russian Journal of Beekeeping “Pchelovodstvo”. 2019. 9: 15 - 19.).
Ильясов Р. А., Дар С. А., Дукку У. Х., Кандемир И., Ли М. Л., Озкан Коса А., Николенко А. Г., Квон Х. В. Современная таксономия пчел Apis mellifera and Apis cerana. Пчеловодство. 2019. 9: 15 - 19. (Ilyasov R. A., Dar S. A., Dukku U. H., Kandemir I., Lee M. L., Ozkan Koca A ., Nikolenko A. G., Kwon H. W. Current taxonomy of honey bees Apis mellifera and Apis cerana (translation). Russian Journal of Beekeeping “Pchelovodstvo”. 2019. 9: 15 - 19.). Аннотация. Проанализированы все доступные исследования A. mellifera и A. cerana с целью упорядочить современную таксономию медоносных пчел. Авторы пересмотрели внутривидовую таксономию европейских и азиатских пчел и показали существование 27 подвидов A. mellifera и 7 подвидов A. cerana. Однако эти данные не окончательные, поскольку некоторые подвиды A. mellifera и A. cerana еще не исследованы.
Abstract. The number of Apis species and their identification methods are discussed. According to different authors, the number of species of the genus varied from 6 to 24. While Apis mellifera inhabits West Asia, Africa and Europe, the ranges of all other species, including Apis cerana, are limited to Asia. A. mellifera and A. cerana are two species widely used in agriculture for the pollination, the production of honey and other products. They have adapted to wide climatic conditions. Intraspecific taxonomy for both species is incomplete and contradictory. In this review, all available studies of A. mellifera and A. cerana are analyzed to ordering the modern taxonomy of honey bees. We found that there are 27 subspecies of A. mellifera and 7 subspecies of A. cerana. However, these data are not ultimate, since some subspecies of A. mellifera and A. cerana remain unexplored. |
241. Yunusbaev U. B., Kaskinova M. D., Ilyasov R. A., Gaifullina L. R., Saltykova E. S., Nikolenko A. G. 2019. The role of whole-genome research in the study of honey bee biology. Russian Journal of Genetics. V. 55 (7). P. 815-824. DOI: 10.1134/S102279541906019X. (Юнусбаев У. Б., Каскинова М. Д., Ильясов Р. А., Гайфуллина Л. Р., Салтыкова Е. С., Николенко А. Г. Роль полногеномных исследований в изучении биологии медоносной пчелы. Генетика. 2019, Т. 55, № 7, с. 815-824. DOI: 10.1134/S102279541906019X.).
Yunusbaev U. B., Kaskinova M. D., Ilyasov R. A., Gaifullina L. R., Saltykova E. S., Nikolenko A. G. 2019. The role of whole-genome research in the study of honey bee biology. Russian Journal of Genetics. V. 55 (7). P. 815-824. DOI: 10.1134/S102279541906019X. (Юнусбаев У. Б., Каскинова М. Д., Ильясов Р. А., Гайфуллина Л. Р., Салтыкова Е. С., Николенко А. Г. Роль полногеномных исследований в изучении биологии медоносной пчелы. Генетика. 2019, Т. 55, № 7, с. 815-824. DOI: 10.1134/S102279541906019X.). Abstract. Given is an overview of original publications devoted to the investigation of the honey bee genome. The history of honey bee genome studies and its characteristics are described. The results of genetic studies of honey bees using genome-wide data are presented. A special focus is put on the search for alleles associated with economically valuable, adaptive, and other important honey bee traits.
Аннотация. В данном обзоре обобщены публикации, посвященные исследованию генома пчелы медоносной. Дана история изучения генома пчелы и его характеристика. Приводятся результаты генетических исследований пчелы с применением полногеномных данных. Особое внимание уделено исследованиям, посвященным поиску аллелей, ассоциированных с хозяйственно полезными, адаптивными и другими важными признаками медоносной пчелы. |
240. Юнусбаев У. Б., Каскинова М. Д., Ильясов Р. А., Гайфуллина Л. Р., Салтыкова Е. С., Николенко А. Г. Роль полногеномных исследований в изучении биологии медоносной пчелы. Генетика. 2019, Т. 55, № 7, с. 778–787. DOI: 10.1134/S0016675819060201. (Yunusbaev U. B., Kaskinova M. D., Ilyasov R. A., Gaifullina L. R., Saltykova E. S., Nikolenko A. G. 2019. The role of whole-genome research in the study of honey bee biology. Russian Journal of Genetics. V. 55 (7). P. 778–787. DOI: 10.1134/S0016675819060201.).
Юнусбаев У. Б., Каскинова М. Д., Ильясов Р. А., Гайфуллина Л. Р., Салтыкова Е. С., Николенко А. Г. Роль полногеномных исследований в изучении биологии медоносной пчелы. Генетика. 2019, Т. 55, № 7, с. 778–787. DOI: 10.1134/S0016675819060201. (Yunusbaev U. B., Kaskinova M. D., Ilyasov R. A., Gaifullina L. R., Saltykova E. S., Nikolenko A. G. 2019. The role of whole-genome research in the study of honey bee biology. Russian Journal of Genetics. V. 55 (7). P. 778–787. DOI: 10.1134/S0016675819060201.). Аннотация. В данном обзоре обобщены публикации, посвященные исследованию генома пчелы медоносной. Дана история изучения генома пчелы и его характеристика. Приводятся результаты генетических исследований пчелы с применением полногеномных данных. Особое внимание уделено исследованиям, посвященным поиску аллелей, ассоциированных с хозяйственно полезными, адаптивными и другими важными признаками медоносной пчелы.
Abstract. Given is an overview of original publications devoted to the investigation of the honey bee genome. The history of honey bee genome studies and its characteristics are described. The results of genetic studies of honey bees using genome-wide data are presented. A special focus is put on the search for alleles associated with economically valuable, adaptive, and other important honey bee traits. |
239. Kim D.I., Kim S.-I., Jung J.W., Ilyasov R.A., Jang D., Lee S.-H., Kwon H.W. Spatial releasing properties and mosquito repellency of cellulose-based beads containing essential oils and vanillin. Journal of Asia-Pacific Entomology. 2019. 22(2) : 409-416. DOI: 10.1016/j.aspen.2018.12.024.
Kim D.I., Kim S.-I., Jung J.W., Ilyasov R.A., Jang D., Lee S.-H., Kwon H.W. Spatial releasing properties and mosquito repellency of cellulose-based beads containing essential oils and vanillin. Journal of Asia-Pacific Entomology. 2019. 22(2) : 409-416. DOI: 10.1016/j.aspen.2018.12.024. Abstract. Porous cellulose beads (Viscopearl) manufactured from wood pulp can provide gradual-release action for aromatic substances. Here we immersed lemongrass oil, xanthoxylum oil, and vanillin to apply mosquito repellents. The volatiles from this Viscopearl were analyzed to obtain information for quality control (QC) or specification using a GC–MS, and its standard compounds were determined as linalool, geranial, neral, and vanillin. In a test using a 20 L chamber, it was confirmed that their constant amounts were released continuously and they did not be affected by light. In another monitoring test for 47 days on the Viscopearl equipped with a commercialized air conditioner operated for 8 hoursh every day under indoor conditions, the amounts of all released components increased in proportion to the open number of the pores on the module, which is a housing case containing the Viscopearl. In addition, the concentration of 8 major components including 3 standard QC compounds (linalool, geranial, and neral) in a repellency test room depended on both the ventilation and elapsed time. The vapor from the module did not affect main 7 plastic units of the air conditioner, whereas the Viscopearl equipped with an air conditioner showed good mosquito repellency under test chamber and room conditions that temperature, relative humidity, and carbon dioxide concentration were controlled at 24.8 ‐ –25.4 °C, 63.8 ‐ –65.7%, and 708 ‐ –1383 ppm, respectively. Therefore, the plant essential oil- based repellent Viscopearl has high potential to be used as human protective agent against indoor mosquitoes by applying it to air conditioners. |
238. Son J.D., Lim S., Kim D.I., Han G., Ilyasov R., Yunusbaev U., Kwon H.W. Automatic bee-counting system with dual infrared sensor based on ICT. Journal of Apiculture. 2019. 34(1) : 47-55. DOI: 10.17519/apiculture.2019.04.34.1.47.
Son J.D., Lim S., Kim D.I., Han G., Ilyasov R., Yunusbaev U., Kwon H.W. Automatic bee-counting system with dual infrared sensor based on ICT. Journal of Apiculture. 2019. 34(1) : 47-55. DOI: 10.17519/apiculture.2019.04.34.1.47. Abstract. Honey bees are a vital part of the food chain as the most important pollinators for a broad palette of crops and wild plants. The climate change and colony collapse disorder (CCD) phenomenon make it challenging to develop ICT solutions to predict changes in beehive and alert about potential threats. In this paper, we report the test results of the bee-counting system which stands out against the previous analogues due to its comprehensive components including an improved dual infrared sensor to detect honey bees entering and leaving the hive, environmental sensors that measure ambient and interior, a wireless network with the bluetooth low energy (BLE) to transmit the sensing data in real time to the gateway, and a cloud which accumulate and analyze data. To assess the system accuracy, 3 persons manually counted the outgoing and incoming honey bees using the video record of 360-minute length. The difference between automatic and manual measurements for outgoing and incoming scores were 3.98% and 4.43% respectively. These differences are relatively lower than previous analogues, which inspires a vision that the tested system is a good candidate to use in precise apicultural industry, scientific research and education. |
237. Kim D.I., Ilyasov R.A., Noh G.R., Lim S.H., Kwon H.W. The negative effect of High Fat Diet on the olfactory system in Drosophila melanogaster. Materials of the 17th International Symposium on Molecular and Neural Mechanisms of Taste and Olfactory Perception (ISMNTOP/YRUF/AISCRIB 2018). 2018.11.30-12.02. Fukuoka, Japan: Kyushu University. P. 42.
Kim D.I., Ilyasov R.A., Noh G.R., Lim S.H., Kwon H.W. The negative effect of High Fat Diet on the olfactory system in Drosophila melanogaster. Materials of the 17th International Symposium on Molecular and Neural Mechanisms of Taste and Olfactory Perception (ISMNTOP/YRUF/AISCRIB 2018). 2018.11.30-12.02. Fukuoka, Japan: Kyushu University. P. 42.
High-fat diet (HFD) often causes obesity, heart disease, cancer and it has detrimental effects on the sensory system. In particular, sensory-mediated responses are crucial for maintaining energy balance, as they are involved in a metabolic regulation; however, little is known about the impact of HFD-induced stress on sensory system. We have used a Drosophila melanogaster model to gain insight on how HFD-induced stress affects physiological, behavioral, and transcriptional changes related with olfactory and nutrient-related signaling. We demonstrated that lifespan and locomotor activiy in HFD-treated flies decreased and that olfactory sensitivity and behavioral responses to odorants were changed. Olfactory sensitivity to eight of ten odorants after 14 days on HFD treatment were reduced, while behavioral attraction was increased to benzaldehyde and 1-hexanol in flies that were treated with HFD for 7 days. This behavioral and physiological modification by HFD treatment was accompanied by a significant decrease in DmOrco gene expression in a peripheral olfactory organ, suggesting that is could be involved in the action of metabolic and sensory signal. Gene expression profiles of antennae showed significant differences on the olfactory receptors, odorant-binding proteins, and insulin signaling. Our results suggested that olfactory sensitivity and behavioral responses to HFD-induced stress are mediated through olfactory and nutrient-related signaling pathways. |
236. Lim S.H., Ilyasov R.A., Noh G.R., Kim D.I., Kwon H.W. Malfuction through single point mutation in an odorant receptor of the major disease vector, Aedes aegypti. Materials of the 17th International Symposium on Molecular and Neural Mechanisms of Taste and Olfactory Perception (ISMNTOP/YRUF/AISCRIB 2018). 2018.11.30-12.02. Fukuoka, Japan: Kyushu University. P. 41.
Lim S.H., Ilyasov R.A., Noh G.R., Kim D.I., Kwon H.W. Malfuction through single point mutation in an odorant receptor of the major disease vector, Aedes aegypti. Materials of the 17th International Symposium on Molecular and Neural Mechanisms of Taste and Olfactory Perception (ISMNTOP/YRUF/AISCRIB 2018). 2018.11.30-12.02. Fukuoka, Japan: Kyushu University. P. 41.
The Aedes aegypti (Ae. aegypti) is a primary vector for dengue virus, the most widespread vector-borne viral disease. Ae. aegypti also acts as a vector of yellow fever, chikungunya and zika virus. Although odorant receptors of Ae. aegypti (AaOrs) has been identified 131 including co-receptor (AaOrco) by bioinformatics analysis, there is a lack of studies about function and structure. We have previously reported that AaOr8 and AaOr49 in the mouth part of mosquito play a major role in mosquito blood-feeding behavior by as detecting the volatile compounds in blood. In this study, we found the ligand binding site of AaOr8 and AaOr49 using SYBYL-X 2.1 packages and homology protein model by the computer program. For demonstrated ligand binding site, we also performed calcium imaging using Sf9 cells with site-directed point mutation AaOrs. AaOr8-S167A in which serine residue in position 167 amino acid was substituted to non-polar and hydrophobic amino acid, alanine, represented a loss of binding affinity to 1-octen-3-ol and cyclohexanol, while AaOr49-V168M where valine in the position 168 amino acid residue was replaced with methionine and AaOr49-Y190A where tyrosine of the position 190 amino acid was substituted to alanine showed complete loss of binding affinity to 2-ethyl-1-hexanol with intact responses to cyclohexanone and benzyl alcohol. Taken togethr, We identified major active residues of AaOr8 and AaOr49 using both in silico and in vitro approach, which should be useful in future research about odorant receptors and control of disease vector insects. |
235. Lim S.H., Kim D.I., Noh G.R., Han G.Y., Lee H.S., Ilyasov R.A., Kwon H.W. Essential olfactory receptors in stylet of the major disease vector Aedes aegypti. Materials of the 6th World Congress of Digital Olfaction Society. 2018.12.03-04. Tokyo, Japan. P. 52. ISBN: 978-2-35609-008-9.
Lim S.H., Kim D.I., Noh G.R., Han G.Y., Lee H.S., Ilyasov R.A., Kwon H.W. Essential olfactory receptors in stylet of the major disease vector Aedes aegypti. Materials of the 6th World Congress of Digital Olfaction Society. 2018.12.03-04. Tokyo, Japan. P. 52. ISBN: 978-2-35609-008-9.
The yellow fever mosquito Aedes aegypti (Ae. aegypti) is a major disease vector for dengue virus. Zika virus, yellow fever and chikungunya. One of the poorty understood aspects of mosquito blood-feeding beaviours is how they target an optimal site in order lo penetrate the skin and blood vessels without alerting the host aninmal. Here we provide new findings that the piercing-sucking stylet of Ae. aegypti is an essential apparatus for the final stage in blood feeding behaviour. Indeed, the stylet possesses olfactory receptor neurons that epress two conventional olfactory receptors of Ae. aegypti (AaOrs), AaOr8, AaOr49, together with the olfactory co-receptor (AaOrco). In vitro calcium imaging using transfected cell lines demonstrated that AaOr8 and AaOr49 were activated by volatile compounds present in blood. Gene expression inhibition of these Ors interferes with blood-feeding behaviours. In silico protein modelling and mutagenesis also demonstrated structural interactons between these Ors and ligands. Taken together we identified olfactory receptor neurons in the stylet invoked in mosquito blood feeding behaviors, which in turn indicates that ofactory percephon in the stylet is necessary and sufficient for mosquitoes to find host blood in order to rapidly acquire blood meals from a host animal. |
234. Ильясов Р.А., Джунг Д.В., Ким Д.И., Ким К.В., Квон Х.В. Сравнительный анализ эффективности обучения двух видов пчел Apis cerana и Apis mellifera. Аграрная Россия. № 11. 2018. С. 41-44. DOI: 10.30906/1999-5636-2018-11-41-44. (Ilyasov R.A., Jung J.W., Kim D.I., Kim K.W., Kwon H.W. Comparative analysis of the effectiveness of training of two types of bees Apis cerana and Apis mellifera. Agrarian Russia. No. 10. 2018. P. 41-44. DOI: 10.30906/1999-5636-2018-11-41-44)
Сравнительный анализ эффективности обучения двух видов пчел Apis cerana и Apis mellifera (Comparative analysis of the effectiveness of training of two types of bees Apis cerana and Apis mellifera)
Ильясов Р.А., Джунг Д.В., Ким Д.И., Ким К.В., Квон Х.В. Сравнительный анализ эффективности обучения двух видов пчел Apis cerana и Apis mellifera. Аграрная Россия. № 11. 2018. С. 41-44. DOI: 10.30906/1999-5636-2018-11-41-44. (Ilyasov R.A., Jung J.W., Kim D.I., Kim K.W., Kwon H.W. Comparative analysis of the effectiveness of training of two types of bees Apis cerana and Apis mellifera. Agrarian Russia. No. 10. 2018. P. 41-44. DOI: 10.30906/1999-5636-2018-11-41-44)
Резюме. Apis cerana и Apis mellifera , сестринские виды пчел, которые разделились около 9 млн лет назад и были геогра фически изолированы до наших дней. Они являются активными опылителями и играют важную роль в сель ском хозяйстве. Для успешного выживания пчелам важно быстро формировать и сохранять разные условные рефлексы. Рабочие пчелы должны помнить путь как к цветущим растениям, так и обратно к ульям. Кроме того, рабочие пчелы должны запоминать запахи многих присутствующих цветов для хорошего ориентирования в пространстве и быстрого сбора нектара и пыльцы. Объектом исследования служили два вида пчел A. cerana и A. mellifera , которых содержали на пасеках Инчхонского национального университета (Южная Корея). Изуча ли рефлекс вытягивания хоботка пчел на действие запахов в период с июня по июль 2017 г. Для эксперимента использовали по 80 рабочих особей пчел каждого вида. Все эксперименты проводили в 4-кратной повторно сти. Показано, что эффективность обучения различается у A. cerana и A. mellifera . Обучение A. cerana происхо дит медленнее A. mellifera , но кратковременная память через 1 ч у A. cerana выражена лучше, чем у A. mellifera. Однако долговременная память через 24 ч гораздо лучше выражена у A. mellifera по сравнению с A. cerana. Результаты эксперимента могут стать важной основой для разработки новых подходов по разведению пчел и опылению растений.
Abstract. Apis cerana and Apis mellifera are sister species of bees that separated about 9 million years ago and have been geographically isolated to the present day. They are active pollinators and play an important role in agriculture. For the successful survival of bees is important to quickly form and maintain different conditioned reflexes. Worker bees need to remember the way to both flowering plants and back to the hives. In addition, the worker bees must remember the smells of many colors for a good orientation in space and collect nectar and pollen. The object of the research was two types of bees, namely: A. cerana and A. mellifera, which were kept at the National University of South Korea (Incheon). The reflex pull of the proboscis of bees to odors in the period from June to July 2017 was studied. For the experiment we used 80 workers bees of each type. All experiments were carried out in 4-fold repetition. It is shown that the effectiveness of training differs from A. cerana and A. mellifera. A. cerana learning occurs slower than A. mellifera, but the short-term memory is better expressed in A. cerana than in A. mellifera. However, the long-term memory in 24 h is much better expressed in comparison with the memory of the A. cerana. The re sults of the experiment can become an important basis for the development of new approaches to the cultivation of bees and pollination of plants.
|
233. Ilyasov,R.A., Han,G.-Y., Lim,S.H., Kim,D.-I. and Kwon,H.W. The genetic structure of Apis cerana population in South Korea based on Vitellogenin gene polymorphism. GenBank. 2018. Accession numbers MH755714-MH755923 (http://www.ncbi.nlm.nih.gov).
LOCUS 01-VG-E2 586 bp DNA linear INV 16-AUG-2018
DEFINITION Apis cerana.
ACCESSION MH755714
KEYWORDS .
SOURCE Apis cerana (Asiatic honeybee)
ORGANISM Apis cerana
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota; Neoptera; Holometabola; Hymenoptera; Apocrita; Aculeata;
Apoidea; Apidae; Apis.
REFERENCE 1 (bases 1 to 586)
AUTHORS Ilyasov,R.A., Han,G.-Y., Lim,S.H., Kim,D.-I. and Kwon,H.W.
TITLE The genetic structure of Apis cerana population in South Korea
based on Vitellogenin gene polymorphism
JOURNAL unpublished
REFERENCE 2 (bases 1 to 586)
AUTHORS Ilyasov,R.A., Han,G.-Y., Lim,S.H., Kim,D.-I. and Kwon,H.W.
TITLE Direct Submission
JOURNAL Submitted (16-AUG-2018) Division of Life Sciences, Incheon National
University, 119 Academy-ro, Yeonsu-gu, Songdo-dong, Incheon 22012,
South Korea
COMMENT Bankit Comment: ALT EMAIL:apismell@mail.ru
Bankit Comment: TOTAL # OF SEQS:35
##Assembly-Data-START
##Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
CDS <1..>586
/gene="VG"
/codon_start=1
/product="Vitellogenin"
/translation="HSWKVGNEYTYLVRSRTLTSLGDLSDVHTGILIKALLTVQAKDS
NVLDAKVWNGQYARIQQSMPDGWETEISDQMLELRDLPISGKPFQIRMKHGLIRDLIV
DRDVPTWEVNLLKSIVAQLQVDTQGNNAIRMNSMQVPTDNDPYASFKAMEDSMGGKCE
VLYDIAPLSDFVIHRSPELVPMPTLKGDGHHMEII"
exon <1..>586
/gene="VG"
/number=2
/label="Exon 2"
gene <1..>586
/gene="VG"
source 1..586
/organism="Apis cerana"
/mol_type="genomic DNA"
/specimen_voucher="Kwon H.W."
/db_xref="taxon:7461"
/ecotype="Icheon, Gyeonggido"
/country="South Korea"
/collection_date="2015"
/collected_by="Kwon H.W."
ORIGIN
1 CACAGTTGGA AAGTCGGGAA TGAGTACACG TATCTCGTTC GAAGTCGCAC ATTGACCAGT
61 TTGGGCGATC TGTCGGACGT GCATACCGGT ATTCTGATAA AGGCGTTGCT CACCGTACAG
121 GCGAAGGATT CGAACGTGCT TGATGCCAAA GTGTGGAATG GCCAGTATGC TCGTATCCAG
181 CAGTCCATGC CCGATGGATG GGAAACGGAG ATCTCCGACC AAATGTTGGA GCTTCGTGAC
241 CTGCCTATTT CCGGCAAACC GTTCCAAATC AGGATGAAAC ATGGCTTGAT CAGGGATCTG
301 ATCGTGGATC GCGACGTTCC CACCTGGGAG GTGAACCTAC TCAAGAGCAT CGTTGCCCAA
361 TTGCAAGTGG ACACTCAAGG TAACAACGCC ATCAGGATGA ACAGCATGCA AGTTCCGACC
421 GACAACGACC CGTACGCTTC GTTCAAAGCC ATGGAGGACT CCATGGGAGG GAAATGCGAG
481 GTTCTCTACG ATATAGCGCC TTTGTCGGAC TTCGTGATCC ACAGATCGCC GGAATTGGTG
541 CCGATGCCGA CGTTGAAGGG CGATGGGCAC CACATGGAGA TCATCA
//
LOCUS TT2_VgE7 421 bp DNA linear INV 16-AUG-2018
DEFINITION Trace of F:\RUSTEM\MATERIALS\SEQUENCE\2018\Vitellogenin\Sequencing
results\Vitellogenin cerana\Exon7 Cerana\!Vg_E7 2018.05.30
foreign\ab1\TT2-E7_Vg_E7_F.ab1; length: 1032; low quality 685;
medium quality 88; high quality 259.
ACCESSION MH755923
KEYWORDS .
SOURCE Apis cerana (Asiatic honeybee)
ORGANISM Apis cerana
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota; Neoptera; Holometabola; Hymenoptera; Apocrita; Aculeata;
Apoidea; Apidae; Apis.
REFERENCE 1 (bases 1 to 421)
AUTHORS Ilyasov,R.A., Han,G.-Y., Lim,S.H., Kim,D.-I. and Kwon,H.W.
TITLE The genetic structure of Apis cerana population in South Korea
based on Vitellogenin gene polymorphism
JOURNAL unpublished
REFERENCE 2 (bases 1 to 421)
AUTHORS Ilyasov,R.A., Han,G.-Y., Lim,S.H., Kim,D.-I. and Kwon,H.W.
TITLE Direct Submission
JOURNAL Submitted (16-AUG-2018) Division of Life Sciences, Incheon National
University, 119 Academy-ro, Yeonsu-gu, Songdo-dong, Incheon 22012,
South Korea
COMMENT Bankit Comment: ALT EMAIL:apismell@mail.ru
Bankit Comment: TOTAL # OF SEQS:35
##Assembly-Data-START
##Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
CDS <1..>421
/gene="VG"
/codon_start=2
/product="Vitellogenin"
/translation="NDFMGPKNCLFRKPEHFIASYALINNQCEGDSLNVAKSLQDHDC
IRQEKTRQSNVISDSESGRSDTEMSTWGHQNVNKHCMIHRTQVKETDDKICFTMHPVV
SCASGCTAVETKLKPYKFHCMEKNEAAMKLKKRIEKGA"
exon <1..>421
/gene="VG"
/number=7
/label="Exon 7"
gene <1..>421
/gene="VG"
source 1..421
/organism="Apis cerana"
/mol_type="genomic DNA"
/specimen_voucher="Kwon H.W."
/db_xref="taxon:7461"
/ecotype="Taichung"
/country="Taiwan"
/collection_date="2015"
/collected_by="Kwon H.W."
ORIGIN
1 CAACGACTTC ATGGGACCCA AGAACTGCCT ATTCAGAAAG CCAGAACACT TCATAGCCAG
61 CTACGCTTTG ATCAATAACC AGTGCGAGGG CGACTCGTTG AACGTGGCGA AATCTCTTCA
121 GGATCACGAT TGCATCCGAC AGGAGAAGAC CCGGCAGAGC AATGTGATCA GCGACAGCGA
181 ATCGGGACGA TCGGACACTG AGATGTCGAC TTGGGGCCAC CAAAATGTTA ACAAACATTG
241 CATGATTCAC AGAACCCAGG TAAAGGAGAC CGACGACAAG ATCTGCTTCA CCATGCATCC
301 AGTAGTCTCT TGCGCGTCTG GTTGCACGGC CGTCGAGACG AAATTGAAAC CGTACAAGTT
361 CCACTGCATG GAGAAGAACG AGGCCGCGAT GAAGCTGAAG AAGAGAATCG AGAAGGGCGC
421 C
//
|
232. Ilyasov R.A, Proshchalykin M.Yu., Leley A.S., Takahashi J., Kwon H.W. The Russian Far East Apis cerana is a distinct subspecies proved from the mitochondrial, nuclear, and morphological data. Materials of the 34th Conference of the Apicultural Society of Korea. Chilgok, Korea. 11-13.10.2018. P. 28. (Ильясов Р.А., Прощалыкин М.Ю., Лелей А.С., Такахаши Д., Квон Х.В. Дальневосточная Apis cerana отдельный подвид по митохондриальным, ядерным и морфологическим данным. Материалы 32-й конференции общества пчеловодов Кореи. Чхильгок, Корея. 11-13.10.2018. C. 28.)
Ilyasov R.A, Proshchalykin M.Yu., Leley A.S., Takahashi J., Kwon H.W. The Russian Far East Apis cerana is a distinct subspecies proved from the mitochondrial, nuclear, and morphological data. Materials of the 34th Conference of the Apicultural Society of Korea. Chilgok, Korea. 11-13.10.2018. P. 28. (Ильясов Р.А., Прощалыкин М.Ю., Лелей А.С., Такахаши Д., Квон Х.В. Дальневосточная Apis cerana отдельный подвид по митохондриальным, ядерным и морфологическим данным. Материалы 32-й конференции общества пчеловодов Кореи. Чхильгок, Корея. 11-13.10.2018. C. 28.)
Apis cerana is the Eastern honeybee species distributed in the most Asian countnes with the tropical climate in the South and the temperate climate in the North. We sequenced and annotated the complete mitochondrial DNA (mtDNA) of A cerana from Vladivostok, Primorskii krai of the Russian Far East and uploaded to database Genbank (APO18450). MtDNA sequence has 15,919 bp length, AT-content 84% and GC-content 16% and contains 22 tRNA genes, 13 protein-coding genes, two nbosomal RNA genes, f one AT-rich region and four non-coding intergenic regions fNCl-4). All protein-coding genes are started by A IT and ATG codons, excepting the start codon of ATP8 gene, which ATC, and are stopped by the common stop codons TAA and TAG. A comparative analysis ot complete mtDNA of A. cerana from Russia. Korea, Taiwan. Malaysia, China, and Japan found that the Russian Far East Apis cerana differ from others on the subpopulation level. Based on comparative analysis of complete mtDNA ( -16,000 bp), nuclear gene lltellogenin (VG) (-4,100 bp) and morphological measurements (six parameters) we assumed that Russian Far-East A. cerana is a distinct northern subspecies, which can be named as a subspecies of Apis cerana ussuriensis.
|
231. Ilyasov R.A., Park J.H., Takahashi J., Lim S.H., Han G.Y., Song J.H., Kwon H.W. Unique subspecies of Asian bees Apis cerana in Korean peninsula. Materials of the 33th Conference of the Apicultural Society of Korea. Gwangju, Korea. 13.04.2018. P. 26. (Ильясов Р.А., Парк Д.Х., Такахаши Д., Лим С.Х., Хан Г.Ю., Сонг Д.-Х., Квон Х.В. Уникальный подвид Apis cerana на Корейском Полуострове. Материалы 32-й конференции общества пчеловодов Кореи. Кванджу, Корея. 13.04.2018. C. 26.)
Ilyasov R.A., Park J.H., Takahashi J., Lim S.H., Han G.Y., Song J.H., Kwon H.W. Unique subspecies of Asian bees Apis cerana in Korean peninsula. Materials of the 33th Conference of the Apicultural Society of Korea. Gwangju, Korea. 13.04.2018. P. 26. (Ильясов Р.А., Парк Д.Х., Такахаши Д., Лим С.Х., Хан Г.Ю., Сонг Д.-Х., Квон Х.В. Уникальный подвид Apis cerana на Корейском Полуострове. Материалы 32-й конференции общества пчеловодов Кореи. Кванджу, Корея. 13.04.2018. C. 26.)
Apis cerana is sisterly related to a honeybee species Apis mellifera, which is highly important in agriculture in most Asian countries. The size of A. cerana population is decreasing every year due to Korean Sacbrood Virus (KSBV) and other diseases. It is believed that A. cerana populations are subdivided into several numbers of subspecies adapted to different climates, similar to Apis mellifera. Full mitochondrial genome of A. cerana from different countries and populations have been studied insufficiently. To date, full mitochondrial DNA (mtDNA) sequence of A. cerana from Korean peninsula have not been researched. Here, we sequenced and annotated the full mitochondrial genome of A.cerana from Jeollanam-do province of South Korea, which is most densely populated area of A. cerana. The mtDNA sequence consisted of 15,925 bp length, A + T content 84% and C + G content 16% and contains 22 tRNA genes, 13 protein-coding genes, 2 ribosomal RNA genes, 1 AT-rich region, and 4 known non-coding intergenic loci (NC1-4). Comparative analysis of A. cerana full mtDNA sequences showed that Korean A. cerana was more similar with Japanese and Chinese samples than Taiwanese species. Japanese and Korean samples were subdivided in one common group located separately. Thus, based on analysis of full mtDNA sequences the samples of Korean A. cerana can be named as subspecies Apis cerana koreana.
|
230. Lim S.H., Ilyasov R.A., Goto K., Noh G.R., Kim D.I., Takahashi J., Kwon H.W. Comparison of mitochondrial genome of two honeybee subspecies, A. mellifera caucasica and A. mellifera carpathica. Materials of the 33th Conference of the Apicultural Society of Korea. Gwangju, Korea. 13.04.2018. P. 40. (Лим С.Х., Ильясов Р.А, Гото К., Нох Г.Р., Ким Д.И., Такахаши Д., Квон Х.В. Сравнение митохондриальных геномов двух подвидов пчел A. mellifera caucasica и A. mellifera carpathica. Материалы 32-й конференции общества пчеловодов Кореи. Кванджу, Корея. 13.04.2018. C. 40.)
Lim S.H., Ilyasov R.A., Goto K., Noh G.R., Kim D.I., Takahashi J., Kwon H.W. Comparison of mitochondrial genome of two honeybee subspecies, A. mellifera caucasica and A. mellifera carpathica. Materials of the 33th Conference of the Apicultural Society of Korea. Gwangju, Korea. 13.04.2018. P. 40. (Лим С.Х., Ильясов Р.А, Гото К., Нох Г.Р., Ким Д.И., Такахаши Д., Квон Х.В. Сравнение митохондриальных геномов двух подвидов пчел A. mellifera caucasica и A. mellifera carpathica. Материалы 32-й конференции общества пчеловодов Кореи. Кванджу, Корея. 13.04.2018. C. 40.)
The complete mitochondrial DNA (mtDNA) sequence of honeybee subspecies A. m. caucasica and A. m. carpathica has been analyzed for the first time. Our results showed that length of A. m. caucasica and A. m. carpathica mtDNA sequences are 16,341 bp and 16,336 bp, respectively. Both sequences contained 13 protein-coding genes, 22 transfer RNA genes, 2 ribosomal RNA genes, and 1 AT-rich region. The overall composition of nucleotides in mtDNA in A. m. caucasica / A. m. carpathica is A (43.2/43.3%), C (9.5/9.6%), G (5.6/5.5%), and T (41.6/41.6%). Most of coding genes (CDS) (ND2, COX1, COX2, ATP8, ATP6, COX3, ND3, ND6, CYTB), and 14 tRNA genes are located on the heavy strand for both sequences. Four CDS genes (ND1, ND4, ND4L, ND5), 2 rRNA genes (12S rRNA, 16S rRNA), and 8 tRNA genes are located on the light strand for both sequences. A comparative analysis of whole mtDNA sequences of A. m. caucasica and A. m. carpathica has showed that A. m. caucasica belonged to the O lineage, in contrast to A. m. carpathica belonging to the C lineage. We suggested 34 SNPs, which allowed to differentiate subspecies A. m. caucasica and A. m. carpathica. These complete mtDNA sequence of honeybee subspecies A. m. caucasica and A. m. carpathica can be useful for further phylogenetic and population genetic studies in honeybees. |
229. Ильясов Р.А., Николенко А.Г., Туктаров В.Р., Гото К., Такахаши Д., Квон Х.В. Митохондриальные геномы пчел подвидов A. m. caucasica и A. m. carpathica. Тезисы докладов XXII Международного Конгресса Апиславия-2018. Москва. 09-13 сентября 2018 г. С. 33-36. 164 с. ISBN 978-5-900205-67-0. (Ilyasov R.A., Nikolenko A.G., Tuktarov V.R., Goto K., Takahashi J.I., Kwon H.W. Mitochondrial genomes of the honeybee subspecies A. m. caucasica и A. m. carpathica. Abstracts of the XXII International Congress of Apislavia-2018. Moscow. 09-13 September 2018. P. 33-36. 164 pp. ISBN 978-5-900205-67-0.)
Ильясов Р.А., Николенко А.Г., Туктаров В.Р., Гото К., Такахаши Д., Квон Х.В. Митохондриальные геномы пчел подвидов A. m. caucasica и A. m. carpathica. Тезисы докладов XXII Международного Конгресса Апиславия-2018. Москва. 09-13 сентября 2018 г. С. 33-36. 164 с. ISBN 978-5-900205-67-0. (Ilyasov R.A., Nikolenko A.G., Tuktarov V.R., Goto K., Takahashi J.I., Kwon H.W. Mitochondrial genomes of the honeybee subspecies A. m. caucasica и A. m. carpathica. Abstracts of the XXII International Congress of Apislavia-2018. Moscow. 09-13 September 2018. P. 33-36. 164 pp. ISBN 978-5-900205-67-0.)
Аннотация. Известно, что генофонд многих подвидов пчел, в том числе A. m. caucasica и A. m. carpathica находятся под угрозой исчезновения вследствие их гибридизации с другими подвидами пчел в пределах естественного ареала (Péntek-Zakar et al., 2015). До настоящего времени полные мтДНК A. m. caucasica и A. m. carpathica не были изучены. В данной работе нами были определены и загружены в Генбанк полные последовательности мтДНК A. m. caucasica (AP018404) and A. m. carpathica (AP018403). Рабочие особи пчел, ранее идентифицированные с использованием морфометрического анализа как подвиды A. m. caucasica и A. m. carpathica (Alpatov, 1948) были отобраны с пасек, расположенных в Сочинском районе Краснодарского края и Майкопском районе Республики Адыгея. Тотальную ДНК извлекали из торакса рабочих особей пчел, используя набор ДНК-ЭКСТРАН (СИНТОЛ, Россия). Нуклеотидные последовательности мтДНК A. m. caucasica и A. m. carpathica были определены в факультете естественных наук Киотского Университета Сангё (Япония) с использованием технологии секвенирования Illumina Next Seq 500 (ILLUMINA, США), используя стандартный протокол для анализа мтДНК медоносной пчелы. Выявленные нуклеотидные последовательности мтДНК были загружены в базы данных DDBJ/GenBank под номерами доступа AP018404 для A. m. caucasica и AP018403 для A. m. carpathica. Полные последовательности мтДНК пчел подвидов A. m. caucasica и A. m. carpathica составили 16341 п.н. и 16336 п.н., соответственно. Мы определили долю нуклеотидов A, C, G и T и наиболее важных пар GC и AT в мтДНК подвидов пчел. Среднее содержание GC и AT-нуклеотидов в мтДНК пчел подвидов A. m. caucasica и A. m. carpathica составляло 15,1% и 84,9%, соответственно. Сравнительный анализ выровненной полной мтДНК A. m. caucasica и A. m. carpathica показал 125 полиморфных сайтов, 30 из которых - инсерции, 40 - делеции, 37 - транзиции, 18 - трансверсии. Соотношение транзиций к трансверсиям в мтДНК составляет 2,05. Сравнительный анализ полной мтДНК A. m. caucasica и A. m. carpathica обнаружил 125 однонуклеотидных полиморфных сайтов (SNP) и показал 99,24% идентичности. МтДНК A. m. caucasica и A. m. carpathica обладали высоким сходством с референсной последовательностью A. m. ligustica (NC_001566) и содержали 13 белок-кодирующих генов, 22 гена тРНК, 2 гена рРНК и АТ-богатую регуляторную область. Некоторые гены мтДНК A. m. caucasica и A. m. carpathica, такие как гены ND2 и тРНК-Cys, ATP6 и ATP8, COX1 и тРНК-Leu, COX2 и тРНК-Asp, перекрываются между собой. Тяжелая цепь мтДНК пчел подвидов A. m. caucasica и A. m. carpathica содержит 9 белок-кодирующих генов, 14 генов тРНК, а легкая цепь мтДНК содержит 4 белок-кодирующих гена, 8 генов тРНК и 2 гена рРНК. Проанализированы полные последовательности митохондриального генома подвидов медоносных пчел A. m. caucasica и A. m. carpathica. Обе последовательности митохондриальной ДНК (мтДНК) содержали 13 белок-кодирующих генов (CDS), 22 гена транспортной РНК (тРНК), 2 гена рибосомальной РНК (рРНК) и одну АТ-богатую регуляторную область. Общий состав нуклеотидов в мтДНК A. m. caucasica / A. m. carpathica - A (43,2 / 43,3%), C (9,5 / 9,6%), G (5,6 / 5,5%) и T (41,6 / 41,6%).
Abstract. It is known that the gene pool of many subspecies of bees, including A. m. caucasica and A. m. carpathica are endangered due to their hybridization with other bees subspecies within the natural range (Péntek-Zakar et al., 2015). Until now, complete mtDNA A. m. caucasica and A. m. carpathica have not been studied. In this paper, we sequenced and uploaded into Genbank complete sequences of mtDNA of A. m. caucasica (AP018404) and A. m. carpathica (AP018403). Worker bees, previously identified using morphometric analysis as subspecies A. m. caucasica and A. m. carpathica (Alpatov, 1948) were collected from apiaries located in the Sochi district of the Krasnodar Krai and the Maikop district of the Republic of Adygea. Total DNA was extracted from the thorax of worker bees using a set of DNA-EXTRAN (SINTOL, Russia). Nucleotide sequences of mtDNA A. m. caucasica and A. m. carpathica were identified in the Faculty of Natural Sciences of Kyoto University of Sangyo (Japan) using Illumina Next Seq 500 sequencing technology (ILLUMINA, USA) using a standard protocol for the analysis of mtDNA of the honeybee. The identified mtDNA nucleotide sequences were uploaded into the DDBJ/GenBank databases under accession numbers AP018404 for A. m. caucasica and AP018403 for A. m. carpathica. The complete sequences of mtDNA honeybee subspecies A. m. caucasica and A. m. carpathica is 16,341 bp. and 16,336 bp, respectively. We determined the contents of nucleotides A, C, G and T and the most important pairs GC and AT in the mtDNA of the bee subspecies. The average content of GC and AT-nucleotides in the mtDNA of honeybee subspecies A. m. caucasica and A. m. carpathica was 15.1% and 84.9%, respectively. Comparative analysis of the aligned full mtDNA A. m. caucasica and A. m. carpathica showed 125 polymorphic sites, 30 of which - insertions, 40 - deletions, 37 - transitions, 18 - transversions. The ratio of transitions to transversions in mtDNA is 2.05. Comparative analysis of total mtDNA A. m. caucasica and A. m. carpathica detected 125 single nucleotide polymorphic sites (SNP) and showed 99.24% identity. MtDNA of A. m. caucasica and A. m. carpathica had a high similarity with the reference sequence A. m. ligustica (NC_001566) and contained 13 protein-coding genes, 22 tRNA genes, 2 rRNA genes and an AT-rich regulatory region. Some mtDNA genes of A. m. caucasica and A. m. carpathica, such as ND2 and tRNA-Cys, ATP6 and ATP8, COX1 and tRNA-Leu, COX2 and tRNA-Asp, overlapped. The heavy chain of mtDNA of honeybee subspecies A. m. caucasica and A. m. carpathica contains 9 protein-coding genes, 14 tRNA genes, and the light chain of mtDNA contains 4 protein-coding genes, 8 tRNA genes, and 2 rRNA genes. The complete sequences of the mitochondrial genome of the honeybee subspecies A. m. caucasica and A. m. carpathica. Both mitochondrial DNA (mtDNA) sequences contained 13 protein-coding genes (CDS), 22 transfer RNA (tRNA) genes, 2 ribosomal RNA (rRNA) genes, and one AT-rich regulatory region. A total composition of nucleotides in mtDNA of A. m. caucasica / A. m. carpathica - A (43.2 / 43.3%), C (9.5 / 9.6%), G (5.6 / 5.5%) and T (41.6 / 41.6%). |
228. Ильясов Р.А., Николенко А.Г., Туктаров В.Р., Гото К., Такахаши Д., Квон Х.В. Митохондриальные геномы кавказской A. m. caucasica и карпатской A. m. carpathica пчел. Известия Уфимского Научного Центра РАН. 2018. № 3(4). С. 35–43. DOI: 10.31040/2222-8349-2018-4-3-35-43. (Ilyasov R.A, Nikolenko A.G., Tuktarov V.R., Goto K., Takahashi J., Kwon H. W. Mitochondrial genomes of Caucasian A. m. caucasica and Carpathian A. m. carpathica honeybees. Proceedings of the RAS Ufa Scientific Centre. 3(4). 2018. P. 35-43. DOI: 10.31040/2222-8349-2018-4-3-35-43.)
Ильясов Р.А., Николенко А.Г., Туктаров В.Р., Гото К., Такахаши Д., Квон Х.В. Митохондриальные геномы кавказской A. m. caucasica и карпатской A. m. carpathica пчел. Известия Уфимского Научного Центра РАН. 2018. № 3(4). С. 35–43. DOI: 10.31040/2222-8349-2018-4-3-35-43. (Ilyasov R.A, Nikolenko A.G., Tuktarov V.R., Goto K., Takahashi J., Kwon H. W. Mitochondrial genomes of Caucasian A. m. caucasica and Carpathian A. m. carpathica honeybees. Proceedings of the RAS Ufa Scientific Centre. 3(4). 2018. P. 35-43. DOI: 10.31040/2222-8349-2018-4-3-35-43.)
Аннотация. Проанализированы полные последовательности митохондриального генома подвидов медоносных пчел A. m. caucasica (16341 п.н.) и A. m. carpathica (16336 п.н.). Обе последовательности митохондриальной ДНК (мтДНК) содержали 13 белок-кодирующих генов (CDS), 22 генов транспортной РНК (тРНК), 2 гена рибосомальной РНК (рРНК) и одну АТ-богатую регуляторную область. Общий состав нуклеотидов в мтДНК A. m. caucasica / A. m. carpathica - A (43,2 / 43,3%), C (9,5 / 9,6%), G (5,6 / 5,5%) и T (41,6 / 41,6%). Показано, что 9 белок-кодирующих генов и 14 генов тРНК расположены на тяжелой цепи, а 4 белок-коди- рующих гена, 2 гена рРНК и 8 генов тРНК расположены на светлой нити для обоих подвидов. Результаты этого исследования могут быть полезны для дальнейших филогенетических и популяционных генетических исследований у пчел.
Abstract. The complete mitochondrial genome sequence of honeybee subspecies A. m. caucasica (16341 bp) and A. m. carpathica (16336 bp) has been analyzed for the first time. Both mitochondrial genome sequences contained 13 protein-coding genes, 22 transfer RNA genes, 2 ribosomal RNA genes, and 1 AT-rich region. The overall composition of nucleotides in mitochondrial DNA (mtDNA) in A. m. caucasica / A. m. carpathica is - A (43,2 / 43,3%), C (9,5 / 9,6%), G (5,6 / 5,5%), and T (41,6 / 41,6%). The 9 CDS, and 14 тРЖ genes are located on the heavy strand for both sequences. Four CDS, 2 rRNA genes, and 8 тРHK genes are located on the light strand for both sequences. Results of this research can be useful for further phylogenetic and population genetic studies in honeybees.
|
227. Каскинова М.Д., Гатауллин А.Р., Хасанов М.В., Ильясов Р.А., Квон Хюн Вук, Николенко А.Г. Оценка чистопородности популяции Apis mellifera mellifera L. на территории заказника Алтын-Солок. Известия Уфимского Научного Центра РАН. 2018. № 3(4). С. 51-56. DOI: 10.31040/2222-8349-2018-4-3-51-56. (Kaskinova M.D., Gataullin A.R., Khasanov M.V., Ilyasov R.A., Kwon Hyung Wook, Nikolenko A.G. The purebredness estimation of Apis mellifera mellifera L. population in the Altyn-Solok conservancy area. Proceedings of the RAS Ufa Scientific Centre. 3(4). 2018. P. 51-56. DOI: 10.31040/2222-8349-2018-4-3-51-56.)
Каскинова М.Д., Гатауллин А.Р., Хасанов М.В., Ильясов Р.А., Квон Хюн Вук, Николенко А.Г. Оценка чистопородности популяции Apis mellifera mellifera L. на территории заказника Алтын-Солок. Известия Уфимского Научного Центра РАН. 2018. № 3(4). С. 51-56. DOI: 10.31040/2222-8349-2018-4-3-51-56. (Kaskinova M.D., Gataullin A.R., Khasanov M.V., Ilyasov R.A., Kwon Hyung Wook, Nikolenko A.G. The purebredness estimation of Apis mellifera mellifera L. population in the Altyn-Solok conservancy area. Proceedings of the RAS Ufa Scientific Centre. 3(4). 2018. P. 51-56. DOI: 10.31040/2222-8349-2018-4-3-51-56.)
Аннотация. Охрана генофонда темной лесной пчелы (Apis mellifera mellifera) на Южном Урале возложена на федеральный заповедник Шульган-таш и заказник РБ Алтын-Солок. Эти ООПТ находятся на территории Бурзянского района, характеризуются горным рельефом и обширными лесными массивами. Мониторинг генетической сохранности бурзянской популяции медоносной пчелы при помощи ДНК-маркеров ведётся нами с 1999 года. Ранее оценку подвидовой принадлежности медоносных пчел из заказника Алтын-Солок проводили в трех населенных пунктах, и для всех семей была подтверждена принадлежность к подвиду A.m.mellifera. Высокий уровень смертности бортевых семей в зимовку 2016-2017 потребовал проведение дополнительного анализа. Цель данной работы – анализ подвидовой принадлежности пчел из заказника Алтын-Солок при помощи девяти SSR маркеров. В исследовании были использованы рабочие пчелы из 45 бортевых семей, расположенных в 20 кварталах заказника Алтын-Солок. В качестве сравнительных групп были использованы выборки A.m.mellifera из Бурзянского района РБ (N = 389), собранные в период с 1999 по 2015 гг., и пчелы из Республики Адыгея (A.m.carnica, N=15), Краснодарского края (A.m.caucasica, A.m.carpatica, N=42) и Закарпатской области Украины (A.m.carpatica, N=15). В четверти исследуемых семей был выявлен аллель Q локуса COI-COII мтДHK, т.е. зафиксирован залёт роёв либо искусственная подсадка в борти семей южных подвидов. Интрогрессия на уровне ядерной ДНК варьиро- вала от 0.019 до 0.342 (при допустимой интрогрессии 0.100). Лишь в 11 из 20 кварталов доля генофонда эволюционной ветви М превышала требуемый уровень чистопородности 0.900. Для сохранения гено- фонда темной лесной пчелы на территории заказника рекомендуется исключить из дальнейшего разведе- ния гибридные семьи. Семьи из кварталов №33, 40, 14, 53, 39, 52 и 81 представляют собой ценный пле- менной материал для дальнейшей селекционной работы.
Abstract. In the southern Urals, the official protection of the gene pool of the dark forest bee (Apis mellifera mellifera) is entrusted to the Shulgan-Tash federal conservancy area and the Altyn-Solok regional conservancy area, which are part of the integrated biosphere reserve of the Bashkir Urals. These protected areas are located on the territory of the Burzyan district, characterized by mountainous terrain and extensive forest areas. Genetic monitoring of the Burzyan population of honey bees with the help of DNA markers has been conducted by our laboratory since 1999. Since then, this population has been monitored for purebreeding. Earlier, an assessment of the honeybee subspecies from the Altyn-Solok was conducted in three localities. It was confirmed that these colonies belong to the A.m.mellifera. The high mortality rate of bee colonies in the winter of 2016-2017 required additional analysis. The aim of this study is to analyze the purebredness of A.m.mellifera population in the Altyn-Solok with the help of nine SSR markers. In this study we used worker bees from 45 colonies. As outgroups were used A.m.mellifera samples from the Burzyan district of the Republic of Bashkortostan (N =389), collected from 1999 to 2015, and bees from the Republic of Adygea (A.m.carnica, N=15), Krasnodar Krai (A.m.caucasica, A.m.carpatica, N=42) and the Zakarpattia Oblast of Ukraine (A.m.carpatica, N=15). In a quarter of the studied colonies, the allele Q of the locus COI-COII mtDNA was identified, i.e. recorded a swarm or importation of southern honeybee subspecies. The introgression at the level of nuclear DNA ranged from 0.019 to 0.342 (with an allowable introgression of 0.100). Only in 11 out of 20 quarters the share of the gene pool of the evolutionary branch M exceeded the required level of purebredness 0.900. To conserve the gene pool of a dark forest bee, it is recommended to exclude hybrid colonies from further breeding. Colonies from quarters № 33, 40, 14, 53, 39, 52 and 81 are valuable breeding material for further breeding work.
|
226. Ильясов Р. А., Хан Г. Ю., Сонг Д. Х., Лим С. Х., Гайфуллина Л. Р., Салтыкова Е. С., Николенко А. Г., Квон Х. В. Нейропептиды медоносной пчелы. Часть 2. Пчеловодство. 2018. № 7. C. 24-26. (Ilyasov R. A., Han G. Y., Song J. H., Lim S. H., Gaifullina L. R. Saltykova E. S., Nikolenko A. G., Kwon H. W. Neuropeptides of honeybees. Part 2 (translation). Russian Journal of Beekeeping “Pchelovodstvo”. 2018. No.7. P. 24-26.)
Ильясов Р. А., Хан Г. Ю., Сонг Д. Х., Лим С. Х., Гайфуллина Л. Р., Салтыкова Е. С., Николенко А. Г., Квон Х. В. Нейропептиды медоносной пчелы. Часть 2. Пчеловодство. 2018. № 7. C. 24-26. (Ilyasov R. A., Han G. Y., Song J. H., Lim S. H., Gaifullina L. R. Saltykova E. S., Nikolenko A. G., Kwon H. W. Neuropeptides of honeybees. Part 2 (translation). Russian Journal of Beekeeping “Pchelovodstvo”. 2018. No.7. P. 24-26.)
Аннотация.
Нейропептиды насекомых участвуют в регуляции поведения, размножения, развития, роста и метаболизма. Нейропептиды играют жизненно важную функцию в пчелиной семье, обеспечивая социальное поведение и кастовую дифференциацию особей. В статье рассмотрены современные данные о классификации, строении, функциях и распространении нейропептидов у пчел и других насекомых. Также описаны особенности биосинтеза, процессинга и экспрессии нейропептидов насекомых. Показано, что нейропептиды могут быть успешно использованы для лечения пчел, для борьбы с насекомыми - вредителями и переносчиками болезней пчел. Вся доступная современная информация о нейропептидах пчел и других насекомых и их GPCR-рецепторах депонирована в специализированную базу данных нейропептидов насекомых DINeR.
Abstract.
Neuropeptides of insects involved in the regulation o f the behavior, reproduction, development, growth and metabolism. Neuropeptides play a vital role in the life of a honeybee colonies, providing social behavior and caste differentiation of individuals.In this paper, current data on the classification, structure, functions, and distribution of neuropeptides in insects have reviewed. Also, the article describes the features of biosynthesis, processing and expression o f honeybee and other insect neuropeptides. We have shown that neuropeptides can be used successfully to the treatment of bees and aslo to control pest-insects of honeybees and parasitic arachnids - bee disease vectors. All available up-to-date information o f honeybee and other insect neuropeptides and their GPCR receptors deposited into the specialized database o f insect neuropeptides DINeR (Database for Insect Neuropeptide Research).
|
225. Ильясов Р. А., Хан Г. Ю., Сонг Д. Х., Лим С. Х., Гайфуллина Л. Р., Салтыкова Е. С., Николенко А. Г., Квон Х. В. Нейропептиды медоносной пчелы. Часть 1. Пчеловодство. 2018. № 6. C. 16-19. (Ilyasov R. A., Han G. Y., Song J. H., Lim S. H., Gaifullina L. R. Saltykova E. S., Nikolenko A. G., Kwon H. W. Neuropeptides of honeybees. Part 1 (translation). Russian Journal of Beekeeping “Pchelovodstvo”. 2018. No.6. P. 16-19.)
Ильясов Р. А., Хан Г. Ю., Сонг Д. Х., Лим С. Х., Гайфуллина Л. Р., Салтыкова Е. С., Николенко А. Г., Квон Х. В. Нейропептиды медоносной пчелы. Часть 1. Пчеловодство. 2018. № 6. C. 16-19. (Ilyasov R. A., Han G. Y., Song J. H., Lim S. H., Gaifullina L. R. Saltykova E. S., Nikolenko A. G., Kwon H. W. Neuropeptides of honeybees. Part 1 (translation). Russian Journal of Beekeeping “Pchelovodstvo”. 2018. No.6. P. 16-19.)
Аннотация.
Нейропептиды насекомых участвуют в регуляции поведения, размножения, развития, роста и метаболизма. Нейропептиды играют жизненно важную функцию в пчелиной семье, обеспечивая социальное поведение и кастовую дифференциацию особей. В статье рассмотрены современные данные о классификации, строении, функциях и распространении нейропептидов у пчел и других насекомых. Также описаны особенности биосинтеза, процессинга и экспрессии нейропептидов насекомых. Показано, что нейропептиды могут быть успешно использованы для лечения пчел, для борьбы с насекомыми - вредителями и переносчиками болезней пчел. Вся доступная современная информация о нейропептидах пчел и других насекомых и их GPCR-рецепторах депонирована в специализированную базу данных нейропептидов насекомых DINeR.
Abstract.
Neuropeptides of insects involved in the regulation o f the behavior, reproduction, development, growth and metabolism. Neuropeptides play a vital role in the life of a honeybee colonies, providing social behavior and caste differentiation of individuals.In this paper, current data on the classification, structure, functions, and distribution of neuropeptides in insects have reviewed. Also, the article describes the features of biosynthesis, processing and expression o f honeybee and other insect neuropeptides. We have shown that neuropeptides can be used successfully to the treatment of bees and aslo to control pest-insects of honeybees and parasitic arachnids - bee disease vectors. All available up-to-date information o f honeybee and other insect neuropeptides and their GPCR receptors deposited into the specialized database o f insect neuropeptides DINeR (Database for Insect Neuropeptide Research).
|
224. Гатауллин А. Р., Каскинова М. Д. , Ильясов Р. А. Генетическая структура популяции медоносной пчелы Нуримановского района республики Башкортостан. Вестник БГАУ. № 1. 2018. С. 48-52. (Gataullin A. , Kaskinova M., Ilyasov R. Genetic structure of the honeybee population in the Nurimanovo district of the Bashkorostan republic. Vestnik BSAU. № 1. 2018. P. 48-52.)
Гатауллин А. Р., Каскинова М. Д. , Ильясов Р. А. Генетическая структура популяции медоносной пчелы Нуримановского района республики Башкортостан. Вестник БГАУ. № 1. 2018. С. 48-52. (Gataullin A. , Kaskinova M., Ilyasov R. Genetic structure of the honeybee population in the Nurimanovo district of the Bashkorostan republic. Vestnik BSAU. № 1. 2018. P. 48-52.)
Аннотация
Генетическая структура популяций медо-носной пчелы в Республике Башкортостан изучена достаточно хорошо – обнаружены чистопо-родные и гибридные популяции темной лесной пчелы. Тем не менее, популяции некоторых районов Республики Башкортостан остались не изученными. Северные районы республики с обширными лесными массивами являются наиболее вероятными местами обитания сохранившейся популяции темной лесной пчелы A.m. mellifera L. В данной работе представлены результаты анализа генетической структуры по-пуляции медоносной пчелы из Нуримановского района РБ, одного из предполагаемых мест сохранения темной лесной пчелы. Оценка генофонда темной лесной пчелы по материнской линии была основана на анализе полиморфизма локуса мтДНК COI-COII и показала гибридное происхождение семей. Генетический анализ структуры выборки с помощью девяти микросателлитных маркеров выявил высокий уровень аутбридинга и дефицита гетерозигот. Результаты исследования позволяют предположить наличие массового завоза семей пчел из южных регионов России подвидов A.m. caucasica и A.m. carpatica в Нуримановский район Республики Башкортостан.
Abstract
The genetic structure of honeybee populations in the Republic of Bashkortostan has been studied quite well. There are purebred and hybrid popula-tions of a dark forest bee. Nevertheless, bee popula-tions in some areas of the Republic of Bashkortostan have not been studied. The northern regions of the republic with extensive forest areas are the most likely habitats of the preserved population of the dark forest bee A.m. mellifera L. This paper presents the results of an analysis of the genetic structure of a honey bee population in the Nurimanovo district of the Bashkortostan Republic, one of the areas where a dark forest bee could survive. Evaluation of the dark forest bee gene pool on the maternal line based on the analysis of the mtDNA COI-COII locus polymorphism showed the hybrid origin of families. A Genetic analysis of the sample structure using nine microsatellite markers revealed a high level of outbreeding and heterozygote deficiency. The results of the study suggest that there is a massive importation of bee colonies of subspecies A.m. caucasica and A.m. carpatica from the southern regions of Russia to the Nurimanovo district of the Republic of Bashkortostan.
|
223. Ильясов Р.А., Хан Г.Ю., Сонг Д.Х., Лим С.Х., Квон Х.В. Особенности биосинтеза нейропептидов насекомых.Экобиотех, 2018, Т. 1, № 1, С. 52-62. DOI: 10.31163/2618-964X-2018-1-1-52-61. (Ilyasov R.A., Han G.Y., Song J.H., Lim S.H., Kwon H.W. Features of the insects neuropeptides biosynthesis. Ecobiotech, 2018, V. 1, No. 1, P. 52-62. DOI: 10.31163/2618-964X-2018-1-1-52-61.)
223. Ilyasov R.A., Han G.Y., Song J.H., Lim S.H., Kwon H.W. Features of the insects neuropeptides biosynthesis. Ecobiotech, 2018, V. 1, No. 1, P. 52-62. DOI: 10.31163/2618-964X-2018-1-1-52-61.)
Ильясов Р.А., Хан Г.Ю., Сонг Д.Х., Лим С.Х., Квон Х.В. Особенности биосинтеза нейропептидов насекомых. Экобиотех, 2018, Т. 1, № 1, С. 52-62. DOI:
10.31163/2618-964X-2018-1-1-52-61. (Ilyasov R.A., Han G.Y., Song J.H., Lim S.H., Kwon H.W. Features of the insects neuropeptides biosynthesis. Ecobiotech, 2018, V. 1, No. 1, P. 52-62. DOI: 10.31163/2618-964X-2018-1-1-52-61.)
Аннотация
В статье рассмотрены современные данные о классификации, строении, функциях и распространении нейропептидов у насекомых. Также в статье описываются
особенности биосинтеза, процессинга и экспрессии нейропептидов насекомых. Вся доступная современная информация о нейропептидах насекомых и их GPCR (G protein– coupled receptors) рецепторах депонирована в специализированную базу данных нейропептидов насекомых DINeR (Database for Insect Neuropeptide
Research). Возможно, что достижения в исследованиях нейропептидов могут быть использованы для создания высокоактивных и экологически безопасных лекарств для
полезных насекомых и средств борьбы с насекомыми- вредителями и переносчиками болезней.
Abstract
In this paper, current data on the classification, structure, functions, and distribution of neuropeptides in insects have reviewed. Also, the article
describes the features of biosynthesis, processing and expression of insect neuropeptides. All available up-to-date information on insect neuropeptides and
their G protein–coupled receptors (GPCR) deposited into the specialized database of insect neuropeptides DINeR (Database for Insect Neuropeptide Research).
Perhaps the advances in of neuropeptide researches can be used to create highly active and ecologically safe drugs for beneficial insects and means of
struggle against pest and disease vectors.
|
222. Джунг Д. В., Ким Д. И., Ильясов Р. А., Ким К. В., Квон Х. В. Особенности памяти у пчел Apis cerana и Apis mellifera. Пчеловодство.
2018. № 4. С. 20-23. (Jung J. W., Kim D. I., Ilyasov R. A., Kim K. W., Kwon H. W. Features of memory in two bee species Apis cerana and Apis mellifera
(translation). Russian Journal of Beekeeping “Pchelovodstvo”. 2018. No. 4. P. 20-23.)
Джунг Д. В., Ким Д. И., Ильясов Р. А., Ким К. В., Квон Х. В. Особенности памяти у пчел Apis cerana и Apis mellifera. Пчеловодство. 2018. № 4. С. 20-23. (Jung
J. W., Kim D. I., Ilyasov R. A., Kim K. W., Kwon H. W. Features of memory in two bee species Apis cerana and Apis mellifera (translation). Russian Journal of
Beekeeping “Pchelovodstvo”. 2018. No. 4. P. 20-23.)
Apis сеrana и Apis mellifera — родственные виды пчел, которые дивергировали несколько миллионов лет назад и были длительное время географически изолированы.
Несколько сотен лет назад эти виды снова встретились в Азии в результате антропогенной деятельности. Оба вида — важные опылители и играют ключевую роль в
жизни человека. Для успешного развития пчелам важно быстро формировать и сохранять разные условные рефлексы. Рабочие пчелы должны помнить путь как к цветущим
растениям, так и обратно к ульям. Кроме того, рабочие пчелы должны запоминать запахи многих присутствующих цветов для хорошего ориентирования в пространстве
и быстрого сбора нектара и пыльцы. Чтобы понять различия в особенностях запоминания и эффективности памяти у двух видов пчел, мы исследовали различия в
формировании обонятельных навыков у A. mellifera и A. cerana на основе рефлекса удлинения хоботка на определенные запахи. Мы установили, что характер
запоминания и эффективность памяти различны у этих видов пчел. Несмотря на большое сходство A. cerana и A. mellifera, формирование условного рефлекса у них
происходит по-разному. Обучение A. cerana идет медленнее, чем A. mellifera, но кратковременная память через 1 ч у A. cerana выражена лучше, чем у A.
mellifera. Однако долговременная память через 24 ч гораздо лучше выражена у A. mellifera. Полученные данные позволяют расширить знания о памяти и
способностях к обучению у видов пчел и могут стать важной основой для разработки новых подходов по разведению пчел и опылению сельскохозяйственных культур.
Apis cerana and Apis mellifera sisterly bee species, which diverged some million years ago and were long time geographically isolated. Last hundreds year ago
these species met again in Asia due human actions. Both species are important pollinators and play key role in human life. For successful development of
bees, it is important to quickly form and maintain various conditioned reflexes. Worker bees must remember the way to both flowering plants, and back to the
hives. As well, worker bees must remember the smells o f most presented flowers for good orientation in space and quickly collecting nectar and pollen. In
order to understand the differences in the memory and memory efficiency of the two species o f bees, we investigated the differences in the formation o f the
olfactory skills of A. mellifera and A. cerana on the basis of the reflex of the elongation o f the proboscis on certain odors. Our present study
demonstrated that learning and memory performance was different between two honeybee species. We showed the species of A. cerana and A. mellifera, despite
their great similarity, have different abilities for forming a conditioned reflex of elongation of the proboscis under the influence of a conditional smell
on the olfactory receptors of the antennae. Learning of A. cerana is slower than A. mellifera, but shortterm memory after 1 hour in A. cerana is expressed
better than A. mellifera. However, the long-term memory after 24 hours is much better expressed in A. mellifera compared to A. cerana. The received data
allow to expand a knowledges about abilities to training and memory of different species of bees and can become an important basis for the development of new
approaches for breeding bees and pollination of crops.
|
221. Джунг Д., Ким Д. И., Ильясов Р. A., Ким К., Квон Х. В. Особенности формирования условных рефлексов у двух видов пчел
Apis cerana и Apis mellifera. Биомика, 2017. Т. 9. № 4. C. 364-369. (Jung J., Kim D. I., Ilyasov R. A., Kim K., Kwon H. W. Features of formation conditional
reflexes in two bee species Apis cerana and Apis mellifera (translation). Biomics, 2017. V. 9(4). P. 364-369.)
Джунг Д., Ким Д. И., Ильясов Р. A., Ким К., Квон Х. В. Особенности формирования условных рефлексов у двух видов пчел Apis cerana и Apis mellifera. Биомика,
2017. Т. 9. № 4. C. 364-369. (Jung J., Kim D. I., Ilyasov R. A., Kim K., Kwon H. W. Features of formation conditional reflexes in two bee species Apis cerana
and Apis mellifera (translation). Biomics, 2017. V. 9(4). P. 364-369.)
Apis cerana и Apis mellifera, родственные виды пчел, которые дивергировали около 6 - 9 миллионов лет назад и были географически изолированы более миллиона
лет. В последние несколько сотен лет назад эти виды снова встретились в Азии в результате антропогенной деятельности. Оба вида являются важными опылителями и
играют ключевую роль в жизни человека. Для успешного развития пчелам важно быстро формировать и сохранять разные условные рефлексы. Рабочие пчелы должны
помнить путь как к цветущим растениям, так и обратно к ульям. Кроме того, рабочие пчелы должны запоминать запахи многих присутствующих цветов для хорошего
ориентирования в пространстве и быстрого сбора нектара и пыльцы. Чтобы понять различия в особенностях запоминания и эффективности памяти у двух видов пчел,
мы исследовали различия в формировании обонятельных навыков A. mellifera и A. cerana на основе рефлекса удлинения хоботка на определенные запахи. Нами
показано, что особенности запоминания и эффективность памяти различны у двух видов пчел. Мы показали, что виды пчел A. cerana и A. mellifera, несмотря на
большое сходство, обладают разными способностями формирования условного рефлекса удлинения хоботка при воздействии условного запаха на обонятельные рецепторы
антенн. Обучение A. cerana происходит медленнее A. mellifera, но кратковременная память через 1 час у A. cerana выражена лучше, чем у A. mellifera. Однако
долговременная память через 24 часа гораздо лучше выражена у A. mellifera по сравнению с A. cerana. Полученные данные позволяют расширить знания о
способностях к обучению и памяти у разных видов пчел и могут стать важной основой для разработки новых подходов по разведению пчел и опылению
сельскохозяйственных культур.
Apis cerana and Apis mellifera sisterly bee species, which diverged about 6 - 9 million years ago and were geographically isolated more than millions years.
Last hundreds year ago these species met again in Asia due human actions. Both species are important pollinators and play key role in human life. For
successful development of bees, it is important to quickly form and maintain various conditioned reflexes. Worker bees must remember the way to both
flowering plants, and back to the hives. As well, worker bees must remember the smells of most presented flowers for good orientation in space and quickly
collecting nectar and pollen. In order to understand the differences in the memory and memory efficiency of the two species of bees, we investigated the
differences in the formation of the olfactory skills of A. mellifera and A. cerana on the basis of the reflex of the elongation of the proboscis on certain
odors. Our present study demonstrated that learning and memory performance was different between two honeybee species. We showed the species of A. cerana and
A. mellifera, despite their great similarity, have different abilities for forming a conditioned reflex of elongation of the proboscis under the influence of
a conditional smell on the olfactory receptors of the antennae. Learning of A. cerana is slower than A. mellifera, but short-term memory after 1 hour in A.
cerana is expressed better than A. mellifera. However, the long-term memory after 24 hours is much better expressed in A. mellifera compared to A. cerana.
The received data allow to expand a knowledges about abilities to training and memory of different species of bees and can become an important basis for the
development of new approaches for breeding bees and pollination of crops. |
220. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Современные методы оценки таксономической принадлежности семей
пчел. Экологическая генетика. 2017. Т. 15. № 4. С. 41–51. DOI: 10.17816/ecogen15441-51. (Ilyasov RA, Poskryakov AV, Nikolenko AG. Modern methods of assessing
the taxonomic affiliation of honeybee colonies (translation). Ecological genetics. 2017. V. 15(4). P. 41-51. DOI: 10.17816/ecogen15441-51).
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Современные методы оценки таксономической принадлежности семей пчел. Экологическая генетика. 2017. Т. 15. № 4.
С. 41–51. DOI: 10.17816/ecogen15441-51. (Ilyasov RA, Poskryakov AV, Nikolenko AG. Modern methods of assessing the taxonomic affiliation of honeybee colonies
(translation). Ecological genetics. 2017. V. 15(4). P. 41-51. DOI: 10.17816/ecogen15441-51).
В ходе эволюции аллопатрически формировалось 30 подвидов медоносной пчелы Apis mellifera L., которые распространены по всей территории Африки, Европы и
Западной Азии. Темная лесная пчела Apis mellifera mellifera — единственный и наиболее ценный подвид для стран Северной и Западной Европы, приспособленный к
продуктивной жизнедеятельности в резко континен- тальном климате Евразии. В последние 100 лет естественная географическая изоляция подвидов была нарушена в
результате деятельности человека. Массовые перемещения семей пчел за пределы границ их ареалов создали угрозу потери чистопородно- сти аборигенных генофондов
подвидов в результате гибридизации. Сохранение генофонда подвидов возможно лишь при контроле транспортировок семей пчел с использованием методов
идентификации таксономической принадлежности. На данный момент разработаны десятки методов идентификации таксономической принадлежности семей пчел, которые
основываются на вариа- бельности частей тела, аллозимных локусов, митохондриальной ДНК, микросателлитных локусов ядерной ДНК, сайтов однонук- леотидных замен
(SNP). Вариабельность микросателлитных локусов и полиморфизм сайтов однонуклеотидных замен показали наибольшую информативность при идентификации
таксономической принадлежности семей пчел.
At least 30 subspecies of the honeybee Apis mellifera L. were formed allopatrically during the evolution, which spreaded throughout all Africa, Europe and
West Asia. The dark forest bee Apis mellifera mellifera is the only and most valuable subspecies for the Northern and Western Europe countries, adapted to
productive living in the hard-continental climate of Eurasia. In the past 100 years, natural geographical isolation of subspecies has been disrupted as a
result of a human activities. Mass transportations of honeybee colonies beyond the boundaries of their area have been threatened of loss the identity of gene
pool of subspecies as a result of hybridization. Preservation of the gene pool of subspecies is possible only when controlling the transportation of honeybee
colonies using the methods of identification of taxonomic affiliation of honeybee colonies. Now, dozens of methods have been developed to identify the
taxonomic affiliation of honeybee's colony, which are based on the variability of body parts, allozyme loci, mitochondrial DNA loci, microsatellite nuclear
loci, sites of single nucleotide polymorphism (SNP). The variability of microsatellite loci and the single nucleotide polymorphism sites have shown the
greatest informativeness in identification of the taxonomic affiliation of honeybee's colony. |
219. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Три сценария эволюции подвидов медоносной пчелы Apis
mellifera. Часть 2. Пчеловодство. 2018. № 2. С. 28-30. (Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Three scenario of evolution of honeybee Apis mellifera
subspecies. Part 2 (translation). Russian Journal of Beekeeping “Pchelovodstvo”. 2018. No.2. P. 28-30.)
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Три сценария эволюции подвидов медоносной пчелы Apis mellifera. Часть 2. Пчеловодство. 2018. № 2. С. 28-30.
(Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Three scenario of evolution of honeybee Apis mellifera subspecies. Part 2 (translation). Russian Journal of
Beekeeping “Pchelovodstvo”. 2018. No.2. P. 28-30.)
АННОТАЦИЯ. Виды пчел A. cerana и A. mellifera географически были разобщены более миллиона назад и до активного вмешательства человека в последние сотни лет
не контактировали друг с другом. Независимо друг от друга A. cerana и A. mellifera подразделились на десятки подвидов, адаптированных к широкому спектру
климатических условий от 30° ю. ш. до 47° с. ш. Старого Света. Вероятно, широкое разнообразие природно-климатических условий привело к формированию 30
подвидов. Значительный прогресс в микроэволюции медоносной пчелы A. mellifera был достигнут в плейстоценовый ледниковый период, когда популяции пчел были
изолированы в многочисленных рефугиях в течение 100 тыс. лет. В статье рассмотрены гипотезы широкой экспансии вида и формирования подвидов медоносной пчелы
на основе данных полиморфизма ядерной и митохондриальной ДНК.
---
ANNOTATION. The bee species A. cerana and A. mellifera geographically diverged more than millions years ago, and they did not contact each other before
active human transporting in the last hundreds of years. Regardless of each other, A. cerana and A. mellifera subdivided into dozens of subspecies, which
adapted to a wide range of climatic conditions from 30° of the south latitude to 47° of the north latitude of the Old World. Probably, a wide diversity of
natural and climatic conditions led to the origin of 30 subspecies. Significant progress in the microevolution of the honeybee A. mellifera was achieved in
the Pleistocene glacial period, when populations of bees were isolated in numerous refugia within 100 thousand years. In the article considered the
hypotheses of wide expansion of species and of origin of honeybee subspecies based on polymorphism of nuclear and mitochondrial DNA.
|
218. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Три сценария эволюции подвидов медоносной пчелы Apis
mellifera. Часть 1. Пчеловодство. 2018. № 1. С. 20-22. (Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Three scenario of evolution of honeybee Apis mellifera
subspecies. Part 1 (translation). Russian Journal of Beekeeping “Pchelovodstvo”. 2018. No.1. P. 20-22.)
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Три сценария эволюции подвидов медоносной пчелы Apis mellifera. Часть 1. Пчеловодство. 2018. № 1. С. 20-22.
(Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Three scenario of evolution of honeybee Apis mellifera subspecies. Part 1 (translation). Russian Journal of
Beekeeping “Pchelovodstvo”. 2018. No.1. P. 20-22.)
АННОТАЦИЯ. Виды пчел A. cerana и A. mellifera географически были разобщены более миллиона назад и до активного вмешательства человека в последние сотни лет
не контактировали друг с другом. Независимо друг от друга A. cerana и A. mellifera подразделились на десятки подвидов, адаптированных к широкому спектру
климатических условий от 30° ю. ш. до 47° с. ш. Старого Света. Вероятно, широкое разнообразие природно-климатических условий привело к формированию 30
подвидов. Значительный прогресс в микроэволюции медоносной пчелы A. mellifera был достигнут в плейстоценовый ледниковый период, когда популяции пчел были
изолированы в многочисленных рефугиях в течение 100 тыс. лет. В статье рассмотрены гипотезы широкой экспансии вида и формирования подвидов медоносной пчелы
на основе данных полиморфизма ядерной и митохондриальной ДНК.
---
ANNOTATION. The bee species A. cerana and A. mellifera geographically diverged more than millions years ago, and they did not contact each other before
active human transporting in the last hundreds of years. Regardless of each other, A. cerana and A. mellifera subdivided into dozens of subspecies, which
adapted to a wide range of climatic conditions from 30° of the south latitude to 47° of the north latitude of the Old World. Probably, a wide diversity of
natural and climatic conditions led to the origin of 30 subspecies. Significant progress in the microevolution of the honeybee A. mellifera was achieved in
the Pleistocene glacial period, when populations of bees were isolated in numerous refugia within 100 thousand years. In the article considered the
hypotheses of wide expansion of species and of origin of honeybee subspecies based on polymorphism of nuclear and mitochondrial DNA.
|
217. Ilyasov R., Noh G.-R., Kim D.-I., Lim S.-H., Song J.-H., Kwon H.-W. Dark forest honeybees Apis mellifera mellifera
L. in the Ural and Volga region. Materials of the 32th Conference of the Apicultural Society of Korea. Nonsan, Korea. 24-25.10.2017. P. 51.
Ильясов Р., Нох Г.-Р., Ким Д.-И., Лим С.-Х., Сонг Д.-Х., Квон Х.-В. Темные лесные медоносные пчелы Apis mellifera mellifera L. на Урале и в Поволжье.
Материалы 32-й конференции общества пчеловодов Кореи. Нонсан, Корея. 24-25.10.2017. C. 51.
Ilyasov R., Noh G.-R., Kim D.-I., Lim S.-H., Song J.-H., Kwon H.-W. Dark forest honeybees Apis mellifera mellifera L. in the Ural and Volga region. Materials
of the 32th Conference of the Apicultural Society of Korea. Nonsan, Korea. 24-25.10.2017. P. 51.
Abstract. Dark forest bee Apis mellifera mellifera is an aboriginal subspecies for the Nordic countries and has an area extending up to 47° of North
Latitude. Despite the fact that the dark forest bee became known for its highly developed protective behavior, it is most preferable for breeding in most
parts of Northern and Central Russia. The gene pool of a dark forest bee is currently threatened because of mass hybridization with imported southern
subspecies A. m. carpathica and A. m. caucasica. Based on molecular population genetics analysis of 9 microsatellite loci (AP243, 4A110, A24, A8, A43, A113,
A88, AP049, A28) in nuclear genome of honeybees A. mellifera and analysis a nucleotide sequences polymorphism of following loci: ND2 mtDNA, COI-COII mtDNA,
VG of nuclear DNA, we developed criteria for identification of native bee subspecies A. m. mellifera. Using method of cluster analysis, we constructed
dendrograms and median networks, which allow differentiating of honeybee subspecies from different evolutionary lineages. We researched a level of
introgressed genes from southern populations in the dark forest bee populations in the Ural and Volga region. Now we began a molecular genetic research in
Korean Apis cerana populations in the Sensory Neurobiology and Biomodeling Laboratory (SNBL) of Incheon National University. Our aims is: comparing genomes
A. mellifera and A. cerana; research of expression of immune-related genes in A. cerana; make a population genomics research of A. mellifera and A. cerana.
---
Ильясов Р., Нох Г.-Р., Ким Д.-И., Лим С.-Х., Сонг Д.-Х., Квон Х.-В. Темные лесные медоносные пчелы Apis mellifera mellifera L. на Урале и в Поволжье.
Материалы 32-й конференции общества пчеловодов Кореи. Нонсан, Корея. 24-25.10.2017. C. 51.
Аннотация. Темная лесная пчела Apis mellifera mellifera является аборигенным подвидом для северных стран и имеет ареал, распространения до 47 ° северной
широты. Несмотря на то, что темная лесная пчела стала известна своим высокоразвитым защитным поведением, она наиболее предпочтительна для разведения в
большинстве районов Северной и Центральной России. Генетический бассейн темной лесной пчелы в настоящее время находится под угрозой из-за массовой
гибридизации с импортированными южными подвидами A. m. carpathica и A. m. кавказский. На основе молекулярного популяционного генетического анализа 9
микросателлитных локусов (AP243, 4A110, A24, A8, A43, A113, A88, AP049, A28) в ядерном геноме медоносных пчел A. mellifera и анализ полиморфизма нуклеотидных
последовательностей следующих локусов: ND2 мДНК, COI-COII мДНК, VG ядерной ДНК, мы разработали критерии идентификации родственных подвидов пчел A. m.
mellifera. Используя метод кластерного анализа, мы построили дендрограммы и медианные сети, которые позволяют дифференцировать подвиды медоносных пчел от
разных эволюционных линий. Мы исследовали уровень интрогрессированных генов из южных популяций в популяциях темных лесных пчел в Урале и Поволжье. Сейчас мы
начали молекулярно-генетическое исследование в корейских популяциях Apis в Лаборатории сенсорной нейробиологии и биомоделирования (СНБЛ) Национального
университета Инчхон. Наши цели: сравнение геномов A. mellifera и A. cerana; исследование экспрессии генов, связанных с иммунной системой, в A. cerana;
провести популяционно геномные исследования A. mellifera и A. cerana. |
216. Jung J., Kim D. I., Ilyasov R., Kim K., Kwon H. W. Comparative study of olfactory learning and memory in Apis
cerana and Apis mellifera foragers. Journal of Apiculture (Korea). 2017. V. 32. No.4. P. 275~280. DOI: 10.17519/apiculture.2017.11.32.4.275. Юнг Дж., Ким Д.
И., Ильясов Р., Ким К., Квон Х. В. Сравнительное изучение обонятельного обучения и памяти в фуражирующих особях Apis cerana и Apis mellifera. Журнал
пчеловодства (Корея). 2017. V. 32. No. 4. P. 275-280. DOI: 10.17519/apiculture.2017.11.32.4.275.
Jung J., Kim D. I., Ilyasov R., Kim K., Kwon H. W. Comparative study of olfactory learning and memory in Apis cerana and Apis mellifera foragers. Journal of
Apiculture (Korea). 2017. V. 32. No.4. P. 275~280. DOI: 10.17519/apiculture.2017.11.32.4.275.
Annotation. The honeybee is an important invertebrate model organism for reward on learning and memory research. Its value as a model organism in this area
is rooted in its impressive capacity for learning and memory formation. Many lines of research have been reported on learning and memory in the last few
decades. However, most research on learning and memory in honeybees has been performed in the Western honeybee, Apis mellifera. Therefore, the cognitive
capabilities in the Eastern honeybee, Apis cerana remain obscure, despite their biological and economical importance. In order to understand the differences
of learning and memory performance in the two species of honeybees, we investigated classical olfactory conditioning according to an appetitive Pavlovian
conditioning paradigm based on the olfactory conditioning of the proboscis extension response (PER). Our present study demonstrated that learning and memory
performance was different between two honeybee species. During the acquisition phase, there was no statistical difference between two species. In the
retention phase, A. cerana was significantly better on olfactory learning and memory than that of A. mellifera after 1 hour. On the other hand, A. mellifera
showed higher learning scores than A. cerana after 24 hours. These findings extend our understandings of mechanisms underlying learning and memory
capabilities, which is an important basis for the further study of behavioral responses to various ecological and biological signals in two closely related
honeybee species.
---
Юнг Дж., Ким Д. И., Ильясов Р., Ким К., Квон Х. В. Сравнительное изучение обонятельного обучения и памяти в фуражирующих особях Apis cerana и Apis mellifera.
Журнал пчеловодства (Корея). 2017. V. 32. No. 4. P. 275-280. DOI: 10.17519/apiculture.2017.11.32.4.275.
Аннотация. Медоносная пчела является важным организмом модели беспозвоночных для вознаграждения за обучение и память исследование. Его ценность как
модельного организма в этой области уходит своими впечатляющими возможностями для обучения и формирование памяти. Сообщалось о многих исследованиях в области
обучения и памяти в последние несколько десятилетий. Однако большинство исследований по изучению и памяти у пчел было выполненный в западной медоносной
пчеле, Apis mellifera. Таким образом, когнитивные способности в Восточной пчела, Apis cerana остаются неясными, несмотря на их биологическое и экономическое
значение. В порядке для понимания различий в обучении и производительности памяти у двух видов пчел, мы исследовали классическое обонятельное
кондиционирование в соответствии с аппетитным павловским кондиционированием парадигмы, основанной на обонятельном обучении ответа на растяжение хобота (PER).
наш настоящее исследование показало, что обучение и производительность памяти различаются между двумя виды медоносных пчел. На этапе приобретения
статистическая разница между двумя виды. В фазе удержания A. cerana значительно улучшилось при обонятельном обучении и памяти чем у A. mellifera через 1 час.
С другой стороны, A. mellifera показал более высокие оценки обучения чем A. cerana через 24 часа. Эти выводы расширяют наше понимание механизмов, лежащих в
основе обучения и памяти, что является важной основой для дальнейшего изучения поведенческих ответы на различные экологические и биологические сигналы у двух
близких видов медоносных пчел.
|
215. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Основные методы идентификации подвидов пчел Apis mellifera. Биомика.
2017. Т.9. № 2. С. 71-82. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Basic methods of identification of honeybee subspecies Apis mellifera (translation).
Biomics. 2017. V. 9. No. 2. P. 71-82.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Основные методы идентификации подвидов пчел Apis mellifera. Биомика. 2017. Т.9. № 2. С. 71-82.
Аннотация. Медоносная пчела является важнейшим фактором, формирующим посредством опыления внешнюю и внутреннюю структуру биоценозов. Для каждого биоценоза
имеет значение не только количество пчел, но и их особенности, которые, в первую очередь, определяются таксономической принадлежностью. Это связано с тем,
что разные подвиды пчел имеют разное предпочтение к видам опыляемых растений. Для сохранения чистопородного генофонда подвидов пчел необходима точная
идентификация таксономической принадлежности семей пчел. Нами описаны основные методы идентификации таксономической принадлежности семей пчел. Наиболее
перспективными для сохранения чистопородных генофондов подвидов медоносной пчелы являются методы анализа однонуклеотидного полиморфизма SNP.
---
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Basic methods of identification of honeybee subspecies Apis mellifera (translation). Biomics. 2017. V. 9. No.
2. P. 71-82.
Annotation. The honey bee is the most important factor that forms the external and internal structure of biocenoses through pollination. For each biocenosis
is important not only the number of bees, but also their traits, which, in first is determined by their taxonomic affiliation. This is due to the fact that
different subspecies of bees have a different preference for the species of plants. To preserve a purebred gene pool of honeybee subspecies, precise
identification of the taxonomic belonging of honeybee colonies is necessary. We have described a methods of identification of taxonomic affiliation of
honeybee colonies are considered. The most promising for the conservation of purebred gene pools of honeybee subspecies are methods of the analysis of single
nucleotide polymorphisms SNPs.
|
214. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Макро- и микроэволюция медоносной пчелы Apis mellifera. Биомика. 2017. Т.9. № 2.
С. 60-70. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Macro- and microevolution of honeybee Apis mellifera (translation). Biomics. 2017. V. 9. No. 2. P.
60-70.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Макро- и микроэволюция медоносной пчелы Apis mellifera. Биомика. 2017. Т.9. № 2. С. 60-70.
Аннотация. Медоносная пчела Apis mellifera L. это единственный вид общественных насекомых, который повсеместно разводится человеком. Кроме медоносной пчелы
существуют такие виды пчел, как, восковая пчела Apis cerana, малая индийская пчела Apis florea, гигантская индийская пчела Apis dorsata, обитающие в
Юго-Восточной Азии. Близкородственные виды пчел A. cerana и A. mellifera дивергировали аллопатрически от 500 тыс. до 1,3 млн. лет назад, и в течение этого
времени не контактировали, в результате чего приобрели устойчивую репродуктивную изоляцию. Таким образом геномы этих видов надежно защищены, но угроза
конкурентного вытеснения A. cerana существует. В последние 100 лет пчела медоносная A. mellifera активно завозится в Азию и постепенно вытесняет A. cerana и
A. florea. Независимо друг от друга у пчел видов A. cerana и A. mellifera сформировалось подвиды под действием широкого диапазона условий окружающей среды.
Нами представлены основные гипотезы экспансии A. mellifera и формирования подвидов. Несмотря на то, что A. mellifera более конкурентоспособна по сравнению с
A. cerana, эта пчела в результате внутривидовой гибридизации, подвержена угрозе потери биоразнообразия генофонда и приспособленности к условиям среды
обитания.
---
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Macro- and microevolution of honeybee Apis mellifera (translation). Biomics. 2017. V. 9. No. 2. P. 60-70.
Annotation. The honeybee Apis mellifera L. is the only species of social insect that is bred everywhere by man. Besides the honeybee, there are bee species
such as, the wax bee Apis cerana, the small Indian bee Apis florea, the giant Indian bee Apis dorsata, inhabiting Southeast Asia. The close related species
of A. cerana and A. mellifera diverged allopatrically from 500,000 to 1.3 million years ago, and during this time they were not contacted, resulting in a
stable reproductive isolation. Thus, the genomes of these species are reliably protected, but the threat of competitive displacement of A. cerana exists. At
the last 100 years, honeybee A. mellifera is actively imported to Asia and gradually displaces A. cerana and A. florea. Regardless of each other, A. cerana
and A. mellifera species were formed subspecies as a result of habitat in a wide range of conditions. We have presented the main hypotheses of the expansion
of A. mellifera and the origin of subspecies. Despite the fact that A. mellifera is more competitive than A. cerana, this honeybee species is subject to the
threat of loss of biodiversity of the gene pool and adaptation to environmental conditions as a result of intraspecific hybridization.
|
213. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Преимущества темной лесной пчелы Apis mellifera mellifera и ее значимость
для России. Биомика. 2017. Т.9. № 2. С. 83-90. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Advantages of the dark forest bee Apis mellifera mellifera and
its importance for Russia (translation). Biomics. 2017. V. 9. No. 2. P. 83-90.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Преимущества темной лесной пчелы Apis mellifera mellifera и ее значимость для России. Биомика. 2017. Т.9. № 2.
С. 83-90.
Аннотация. Темная лесная пчела Apis mellifera mellifera это аборигенный подвид для стран Северной Европы и имеет ареал, распространяющийся до 47° с.ш.
Несмотря на то, что темная лесная пчела известна своим сильно развитым защитным поведением, она является наиболее предпочтительной для разведения на большей
части территории Северной и Центральной России. Это связано с тем, что темная лесная пчела способна успешно, без ущерба для своего здоровья и без лишних
потерь пережить без облета длительный и морозный зимний период в течение более 6 месяцев. Такими уникальными качествами не обладает ни один из известных
подвидов пчел. Однако генофонд темной лесной пчелы на данный момент находится под угрозой исчезновения в результате массовой гибридизации с импортируемыми
южными подвидами A. m. carpathica и A. m. caucasica. В данной статье описаны наиболее ценные качества темной лесной пчелы, ее роль для сельского хозяйства
России и причины сокращения численности семей.
---
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Advantages of the dark forest bee Apis mellifera mellifera and its importance for Russia (translation).
Biomics. 2017. V. 9. No. 2. P. 83-90.
Annotation. Dark forest bee Apis mellifera mellifera is an aboriginal subspecies for the Nordic countries and has an area extending up to 47° N.W. Despite
the fact that the dark forest bee became known for its highly developed protective behavior, it is most preferable for breeding in most parts of Northern and
Central Russia. This is due to the fact that a dark forest bee is capable of successfully surviving a long and frosty winter period for more than 6 months
without damaging its health and without unnecessary losses without flying around. Such unique qualities are not possessed by any of the known subspecies of
honeybees. However, the gene pool of a dark forest bee is currently threatened with extinction as a result of mass hybridization with imported southern
subspecies A. m. carpathica and A. m. caucasica. This article describes the most valuable qualities of a dark forest bee, its role for Russian agriculture
and the reasons for the decline in the number of colonies. |
212. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Молекулярно-генетические и биохимические методы оценки
таксономической принадлежности семей пчел. Часть 2. Пчеловодство. 2017. № 8. С. 23-26. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Molecular-genetic and
biochemical methods of assessing of the taxonomic status of the honeybee colonies. Part 2 (translation). Russian Journal of Beekeeping “Pchelovodstvo”. 2017.
No.8. P. 23-26.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Молекулярно-генетические и биохимические методы оценки таксономической принадлежности семей пчел. Часть 2.
Пчеловодство. 2017. № 8. С. 23-26.
Аннотация. В процессе аллопатрической эволюции сформировалось 30 подвидов медоносной пчелы Apis mellifera L. Под влиянием природных и антропогенных факторов
изоляция географических подвидов пчел была нарушена и аборигенным генофондам подвидов стала угрожать опасность интрогрессии и замещения геномов. Сохранение
аборигенных генофондов медоносной пчелы представляет большее значение для успешного пчеловодства. Для сохранения чистопородного генофонда подвидов пчел
необходима точная идентификация таксономической принадлежности семей пчел. В статье представлены возможности молекулярногенетических и биохимической методов
для оценки таксономической принадлежности семей пчел. Наиболее перспективными и информативными при оценке таксономической принадлежности пчел являются методы
на основе анализа однонуклеотидного полиморфизма (SNP).
---
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Molecular-genetic and biochemical methods of assessing of the taxonomic status of the honeybee colonies. Part 2
(translation). Russian Journal of Beekeeping “Pchelovodstvo”. 2017. No.8. P. 23-26.
Annotation. In the process of allopatric evolution, 30 subspecies of the honeybee Apis mellifera L. were formed. Under the influence of natural and
anthropogenic factors, the isolation of geographical subspecies of honeybees was violated and the aboriginal gene pools of subspecies became threatened with
introgression and genome substitution. For humans the preservation of indigenous gene pool of honeybees has greater importance for successful and sustained
beekeeping. To preserve a purebred gene pool of honeybee subspecies, correct identification of the taxonomic belonging of honeybee colonies is necessary. The
article presents the possibilities of molecular-genetic and biochemical methods for assessing the taxonomic affiliation of honeybee colonies. The most
promising and informative in assessing the taxonomic affiliation of honeybees are methods based on the analysis of single nucleotide polymorphism (SNP).
|
211. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Молекулярно-генетические и биохимические методы оценки
таксономической принадлежности семей пчел. Часть 1. Пчеловодство. 2017. № 7. С. 13-16. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Molecular-genetic and
biochemical methods of assessing of the taxonomic status of the honeybee colonies. Part 1 (translation). Russian Journal of Beekeeping “Pchelovodstvo”. 2017.
No.7. P. 13-16.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Молекулярно-генетические и биохимические методы оценки таксономической принадлежности семей пчел. Часть 1.
Пчеловодство. 2017. № 7. С. 13-16.
Аннотация. В процессе аллопатрической эволюции сформировалось 30 подвидов медоносной пчелы Apis mellifera L. Под влиянием природных и антропогенных факторов
изоляция географических подвидов пчел была нарушена и аборигенным генофондам подвидов стала угрожать опасность интрогрессии и замещения геномов. Сохранение
аборигенных генофондов медоносной пчелы представляет большее значение для успешного пчеловодства. Для сохранения чистопородного генофонда подвидов пчел
необходима точная идентификация таксономической принадлежности семей пчел. В статье представлены возможности молекулярногенетических и биохимической методов
для оценки таксономической принадлежности семей пчел. Наиболее перспективными и информативными при оценке таксономической принадлежности пчел являются методы
на основе анализа однонуклеотидного полиморфизма (SNP).
---
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Molecular-genetic and biochemical methods of assessing of the taxonomic status of the honeybee colonies. Part 1
(translation). Russian Journal of Beekeeping “Pchelovodstvo”. 2017. No.7. P. 13-16.
Annotation. In the process of allopatric evolution, 30 subspecies of the honeybee Apis mellifera L. were formed. Under the influence of natural and
anthropogenic factors, the isolation of geographical subspecies of honeybees was violated and the aboriginal gene pools of subspecies became threatened with
introgression and genome substitution. For humans the preservation of indigenous gene pool of honeybees has greater importance for successful and sustained
beekeeping. To preserve a purebred gene pool of honeybee subspecies, correct identification of the taxonomic belonging of honeybee colonies is necessary. The
article presents the possibilities of molecular-genetic and biochemical methods for assessing the taxonomic affiliation of honeybee colonies. The most
promising and informative in assessing the taxonomic affiliation of honeybees are methods based on the analysis of single nucleotide polymorphism (SNP).
|
210. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Семь причин смертности семей пчелы Apis mellifera mellifera в России.
Пчеловодство. 2017. № 9. С. 10-14. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Seven causes of mortality of the dark forest honeybee Apis mellifera
mellifera colonies in Russia (translation). Russian Journal of Beekeeping “Pchelovodstvo”. 2017. No.9. P. 10-14.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Семь причин смертности семей пчелы Apis mellifera mellifera в России. Пчеловодство. 2017. № 9. С. 10-14.
Аннотация. Пчелы играют исключительную роль в поддержании биологического и таксономического разнообразия природных и антропогенных экосистем в результате
опылительной деятельности, а также в обеспечении человека пищей и биологически активными и лекарственными веществами. Темная лесная пчела Apis mellifera
mellifera имеет высокую значимость в пчеловодстве и сельском хозяйстве России. Этот подвид пчел идеально приспособлен к жизни и продуктивной деятельности в
природно-климатических условиях Центральной и Северной России. Однако в России происходит повышение смертности и сокращение общей численности семей пчел, в
частности темной лесной пчелы. В данной статье представлено семь наиболее значимых факторов, приводящих к повышению смертности и снижению численности семей
пчел в России.
---
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Seven causes of mortality of the dark forest honeybee Apis mellifera mellifera colonies in Russia
(translation). Russian Journal of Beekeeping “Pchelovodstvo”. 2017. No.9. P. 10-14.
Annotation. Honeybees play an exceptional role in maintaining the biological and taxonomic diversity of natural and anthropogenic ecosystems as a result of
pollination activities, as well as in providing humans with food and biologically active and medicinal substances. The dark forest honeybee Apis mellifera
mellifera has high significance in the beekeeping and agriculture of Russia. This subspecies of honeybees is ideally adapted to life and productive
activities in the natural and climatic conditions of Central and Northern Russia. However, an increase of mortality and a reduction of the total number of
honeybee colonies there is in Russia, in particular, of the dark forest honeybee. This article presents the seven most significant factors leading to an
increase of mortality and a decrease of the number of honeybee colonies in Russia.
|
209. Ильясов Р. А., Поскряков А. В., Николенко А. Г. Генофонд темной лесной пчелы A. m. mellifera бурзянской популяции. Материалы
Международной научно-практической конференции по пчеловодству "Современные проблемы пчеловодства". ФГБОУ ВО «Чеченский государственный
университет»: Грозный. 2017 (15–18 мая 2017 г.). С. 120-123. (Ilyasov R. A., Poskryakov A. V., Nikolenko A. G. The gene pool of the dark forest
bee A. m. mellifera burzyansky population. Materials of the International scientific and practical conference on beekeeping "Modern problems of beekeeping".
FGBOU VO "Chechen State University": Grozny. 2017 (May 15-18, 2017). P. 120-123.).
Ильясов Р. А., Поскряков А. В., Николенко А. Г. Генофонд темной
лесной пчелы A. m. mellifera бурзянской популяции. Материалы Международной научно-практической конференции по пчеловодству "Современные проблемы
пчеловодства". ФГБОУ ВО «Чеченский государственный университет»: Грозный. 2017 (15–18 мая 2017 г.). С. 120-123. (Ilyasov R. A., Poskryakov
A. V., Nikolenko A. G. The gene pool of the dark forest bee A. m. mellifera burzyansky population. Materials of the International scientific and practical
conference on beekeeping "Modern problems of beekeeping". FGBOU VO "Chechen State University": Grozny. 2017 (May 15-18, 2017). P. 120-123.). Аннотация.
Проведен мониторинг генофонда популяции темной лесной пчелы Бурзянского района Республики Башкортостан на основе изучения полиморфизма 9 микросателлитных
локусов яДНК. Выполнена оценка уровня интрогрессии «южных» генов по годам и по отдельным выборкам для разных годов исследований. Показана высокая
стабильность и чистота генофонда популяции темной лесной пчелы Бурзянского района со средним уровнем интрогрессии «южных» генов 2,7%.
Представлена высокая эффективность сохранения чистоты генофонда A. m. mellifera на территории природо-охранных организаций - заповедников, национальных
парков и заказников. (Abstract. Carried out monitoring of the population's gene pool dark forest bees burzyansky district of the Republic of Bashkortostan on
the basis of study of polymorphism of 9 microsatellite loci, agnc. Assess the level of introgression of the "southern" genes by year and by individual sample
size for different study years. The high stability and the purity of the gene pool of the population of the dark forest bees burzyansky district with the
average level of introgression of the "southern" genes of 2.7%. Presents high efficiency maintain the purity of the gene pool of A. m. mellifera on the
territory of environmental organizations - nature reserves, national parks and sanctuaries.) |
208. Ilyasov R. A., Poskryakov A. V., Nikolenko A. G. The population of the purebred dark European honeybees Apis
mellifera mellifera in the Urals and the Volga region. NordBi-Aktuellt (Sweden). 2017. No.1. P. 14-15.
The population of the purebred dark European
honeybees Apis mellifera mellifera in the Urals and the Volga region. (Популяция чистопородной темной лесной пчелы Apis mellifera mellifera на Урале и в
Поволжье). Ilyasov R. A., Poskryakov A. V., Nikolenko A. G. The population of the purebred dark European honeybees Apis mellifera mellifera in the Urals and
the Volga region. NordBi-Aktuellt (Sweden). 2017. No.1. P. 14-15. Abstract The local populations of the dark European honeybees Apis mellifera mellifera from
the Urals and the Volga region were examined in this work. The genetic analysis of populations and colonies was performed based on the polymorphism of 9
microsatellite loci of the nuclear genome. We found some level of the introgression in the native genetic pool of the A.m.mellifera in the Urals and the
Volga Region by hybridization with introduced from Caucasus a “southern” subspecies Apis mellifera carpatica and Apis mellifera caucasica. The
greatest proportion of the remaining indigenous gene pool of A. m. mellifera is the core of the gene pool of the population of the subspecies A. m.
mellifera, which distributed over the entire territory of Perm krai and the north of the Republic of Bashkortostan. For the remaining population of A. m.
mellifera of the Urals and the Volga region. Finally, we found biggest reserves of native gene pool of A. m. mellifera in the Urals and Volga region, which
contain about thousand colonies of pure dark European honeybees. Vi har i nordbiprojektet ibland frågat oss: hur står det till med det nordiska
biet i Ryssland? Det har ju funnits ända bort till Uralbergen, men hur är det idag. Nu har vi fått kontakt via Sicamm med bl a Rustem
Ilyasov, som forskar om det nordiska biets utbredning i Ryssland och även fått hans dokktorsavhandling, som här finns i väsentliuga
delar. Hoppas inte det engelska språket ska vara ett hinder. В этой работе были изучены местные популяции темных европейских пчел Apis mellifera
mellifera с Урала и Поволжья. Генетический анализ популяций и колоний проводился на основе полиморфизма 9 микросателлитных локусов ядерного генома. Мы
обнаружили некоторый уровень интрогрессии в природном генетическом бассейне A.m.mellifera на Урале и Поволжье путем гибридизации с введенным с Кавказа
«южным» подвидом Apis mellifera carpatica и Apis mellifera caucasica. Наибольшая доля оставшегося местного генофонда A. m. Mellifera является
ядром генофонда популяции подвидов A. m. mellifera, которые распространялись по всей территории Пермского края и севера Республики Башкортостан. Для
сохранения популяции A. m. mellifera Урала и Поволжья. Наконец, мы обнаружили самые большие запасы природного генофонда A. m. mellifera на Урале и в
Поволжье, в которых содержится около тысячи колоний чистопородных темных европейских пчел. |
207. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. The genome of the honey bee Apis mellifera in comparison with fruit fly
Drosophila melanogaster. In book: The value of biodiversity of bees in maintaining homeostasis of ecosystems / Ed. V.A. Sysuev, A.Z. Brandorf, Kirov:
Agricultural Research Institute of the North–East, 2017. 308 p. P. 77 - 82. ISBN 978-5-7352-0149-6.
Ilyasov R.A., Poskryakov A.V., Nikolenko
A.G. The genome of the honey bee Apis mellifera in comparison with fruit fly Drosophila melanogaster. In book: The value of biodiversity of bees in
maintaining homeostasis of ecosystems / Ed. V.A. Sysuev, A.Z. Brandorf, Kirov: Agricultural Research Institute of the North–East, 2017. 308 p. P. 77 -
82. ISBN 978-5-7352-0149-6. Ильясов Р. А., Поскряков А. В., Николенко А. Г. Геном медоносной пчелы Apis mellifera в сравнении с плодовой мушкой Drosophila
melanogaster. В книге: Роль биоразнообразия пчелиных в поддержании гомеостаза экосистем / ред. В. А. Сысуева, А. З. Брандорф. Киров: НИИСХ
Северо–Востока, 2017. 308 с. С. 77 - 82. ISBN 978-5-7352-0149-6. The analisis of the nuclear and the mitochondrial genomes of the honey bee Apis
mellifera in comparison with the well–annotated, finished fruit fly Drosophila melanogaster genome was presented in this article. The nuclear genome of
the honey bee has about 245 millions b. p., which distributed in 16 chromosomes and contains about 10 thousands genes. The mitochondrial genome of the A.
mellifera has about 16 thousands b. p., which located in mitochondrions and contains 35 genes. The nuclear genome of the fruit fly has about 144 millions b.
p., which distributed in 4 chromosomes and contains about 17 thousands genes. The mitochondrial genome of the D. melanogaster has about 19 thousands b. p.,
which located in mitochondrions and contains 37 genes. В статье представлен сравнительный анализ ядерного и митохондриального геномов медоносной пчелы Apis
mellifera и плодовой мушки Drosophila melanogaster. Ядерный геном медоносной пчелы имеет размер около 245 миллионов п. н., который распределен в 16 хромосом
и содержит около 10 тысяч генов. Митохондриальный геном A. mellifera имеет размер около 16 тысяч п. н., который расположен в митохондриях и содержит 35
генов. Ядерный геном плодовой мушки имеет размер около 144 миллионов п. н., который дифференцирован в 4-х хромосомах и содержит около 17 тысяч генов.
Митохондриальный геном D. melanogaster имеет размер около 19 тысяч п. н., который находится в митохондриях и содержит 37 генов.
|
206.
Ильясов Р. А., Поскряков А. В., Николенко А. Г. Сохранение генофонда
темной лесной пчелы бурзянской популяции A. m. mellifera. В книге: Роль
биоразнообразия пчелиных в поддержании гомеостаза экосистем / ред. В.
А. Сысуева, А. З. Брандорф. Киров: НИИСХ Северо–Востока, 2017.
308 с. С. 46 - 50. ISBN 978-5-7352-0149-6.
Ильясов Р. А., Поскряков А. В., Николенко А. Г. Сохранение генофонда
темной лесной пчелы бурзянской популяции A. m. mellifera. В книге: Роль
биоразнообразия пчелиных в поддержании гомеостаза экосистем / ред. В.
А. Сысуева, А. З. Брандорф. Киров: НИИСХ Северо–Востока, 2017.
308 с. С. 46 - 50. ISBN 978-5-7352-0149-6.
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. A conservation of the
gene pool of the burzyan population of dark forest bee A. m. mellifera.
In book: The value of biodiversity of bees in maintaining homeostasis
of ecosystems / Ed. V.A. Sysuev, A.Z. Brandorf, Kirov: Agricultural
Research Institute of the North–East, 2017. 308 p. P. 46 - 50.
ISBN 978-5-7352-0149-6.
Проведен мониторинг генофонда популяции темной лесной пчелы Бурзянского
района Республики Башкортостан на основе изучения полиморфизма 9
микросателлитных локусов яДНК. Выполнена оценка уровня интрогрессии
«южных» генов по годам и по отдельным выборкам для разных
годов исследований. Показана высокая стабильность и чистота генофонда
популяции темной лесной пчелы Бурзянского района со средним уровнем
интрогрессии «южных» генов 2.7%. Представлена высокая
эффективность сохранения чистоты генофонда A. m. mellifera на
территории природоохранных организаций — заповедников,
национальных парков и заказников.
Monitoring of the gene pool of the dark forest bee population of the
Burzyansky district of the Republic of Bashkortostan based on the study
of a polymorphism of 9 microsatellite loci of the nuclear DNA. The
level of «southern» genes introgression for samples by
years and for every samples researches in different years was
evaluated. The high stability and purity of the gene pool of a of dark
forest bees population of the Burzyansky district with average level of
introgression of «southern» genes 2.7% was shown. The high
efficiency of the conservation of the gene pool purity of the A. m.
mellifera on the territory of a preserving nature organizations -
reserves, national parks and sanctuaries.
|
205.
Ильясов Р.А. Генетическая структура популяции и филогенетическое
положение темной лесной пчелы Apis mellifera mellifera L. Урала и
Поволжья. Диссертация на соискание ученой степени доктора биологических
наук. Уфа. 2016. 326 с.
Ильясов Р.А. Генетическая структура популяции и филогенетическое
положение темной лесной пчелы Apis mellifera mellifera L. Урала и
Поволжья. Диссертация на соискание ученой степени доктора биологических
наук. Уфа. 2016. 326 с. (Ilyasov R.A. The genetic structure of
population and phylogenetic position of the dark European bees Apis
mellifera mellifera L. in the Urals and Volga region. Dissertation for
the degree of Doctor of Biological Sciences. Ufa. 2016. P. 326.). На
основе сравнительного анализа нуклеотидных последовательностей генов
ядерного и митохондриального геномов была выявлена высокая
информативность для филогенетических реконструкций 7 генов мтДHK (ND2,
ND4, ND4L, ND5, ND6, COI, COIII) и гена вителлогенина VG яДHK
медоносной пчелы.
В результате сравнительного анализа нуклеотидных последовательностей
локуса COI-COII мтДHK было показано, что уральская и поволжская
популяции темной лесной пчелы отличаются от европейских популяций A. m.
mellifera по SNP 912 G>A относительно референсной последовательности
Nc001566 в Генбанке.
Обнаружены SNPs митохондриального (SNP 816 C>T в гене ND2 мтДHK
относительно референсной последовательности Nc001566) и ядерного (22
SNPs и 2 двойные SNPs 2887-2888 AA>TC и 4508-4509 GG>AA в гене VG
яДHK относительно референсной последовательности Nс007073) геномов,
позволяющие проводить селекцию темной лесной пчелы A. m. mellifera.
Подтверждено вхождение в эволюционную ветвь М и тесное генетическое
родство темной лесной пчелы уральской популяции с европейскими
популяциями A. m. mellifera на основе сравнительного анализа
нуклеотидной последовательности гена VG яДHK, гена ND2 мтДHK и локуса
COI-COII мтДHK.
На основе геногеографического анализа интрогрессии “южных”
генов по ядерному (9 микросателлитных локусов) и митохондриальному
(локус COI-COII) геномам на Урале и в Поволжье обнаружены и
локализованы ареалы пяти сохранившихся популяций (резерватов) темной
лесной пчелы A. m. mellifera (бурзянская, татышлинская,
южно-прикамская, вишерская, камбарская).
На основе анализа полиморфизма 9 микросателлитных локусов яДHK были
рассчитаны генетические стандарты для популяции (Ho=0.24, Hs=0.23,
Ht=0.28, Fis=0.06, Fit=0.14, Fst=0.17) и семьи (Ho=0.20, Hs=0.16,
Ht=0.15, Fis=0.23, Fit=0.35, Fst=0.11) темной лесной пчелы A. m.
mellifera.
Анализ полиморфизма 9 микросателлитных локусов яДHK и локуса COI-COII
мтДHK позволил определить уровень интрогрессии “южных”
генов в популяции темной лесной пчелы Урала и Поволжья. Процесс
гибридизации A. m. mellifera происходил в результате интродукции
пчелиных семей других подвидов из южных регионов России.
На основе полиморфизма 9 микросателлитных локусов яДHK была предложена
методика селекции семей темной лесной пчелы с интрогрессией
“южных” генов не более 5%, и генетическими показателями,
характерными для чистопородных семей A. m. mellifera (Ho ≤ 0.30, Hs
≤ 0.30, Ht ≤ 0.30, Fis ≤ │0.45│, Fit ≤ │0.55│, Fst ≥
│0.11│). Качество селектируемого материала будет определяться числом
показателей, которым соответствует анализируемая семья пчел. Такая
селекция позволит поддерживать генетическое и генотипическое
разнообразие в рамках генетического стандарта подвида A. m. mellifera.
The high informativeness of the seven mitochondrial genes (ND2, ND4,
ND4L, ND5, ND6, COI, COIII) and the gene vitellogenin VG for
phylogenetic reconstructions of honeybees have found based on
comparative analysis of the nucleotide sequences.
The populations of the dark European honeybees of the Urals and Volga
region differ from the European populations of the A. m. mellifera by
SNP 912 G>A relative to the reference sequence Nc001566 have showed
based on a comparative analysis of the nucleotide sequences of the
locus COI-COII of the mitochondrial DNA.
The SNPs of the mitochondrial DNA (SNP 816 C> T in the ND2 gene of
mtDNA relative to the reference sequence Nc001566) and nuclear DNA (22
SNPs and 2 double SNPs 2887-2888 AA> TC and 4508-4509 GG> AA in
the VG gene of the nuclear DNA relative to the reference sequence
Nc007073) which allows to select the dark European honeybees A. m.
mellifera have found based on a comparative analysis of the nucleotide
sequences.
An including to the M evolutionary lineage of Apis mellifera and a
close genetic relationship of the dark European honeybees of the Ural
and Volga region populations with European populations have confirmed
based on a comparative analysis of the nucleotide sequences of the gene
vitellogenin VG of the nuclear DNA, of the locus COI-COII and the gene
ND2 of the mitochondrial DNA.
An area of the five preserved populations (reserves) of the dark
European honeybees A. m. mellifera (named burzyanskaya, tatyshlinskaya,
yuzhno-prikamskaya, visherskaya, kambarskaya) have found and localized
based on gene geographic analysis of the introgression of
“southern” genes of nuclear (9 microsatellite loci) and
mitochondrial (COI-COII locus) in the the Urals and Volga region.
The genetic standards of populations (Ho=0.24, Hs=0.23, Ht=0.28,
Fis=0.06, Fit=0.14, Fst=0.17) and colonies (Ho=0.20, Hs=0.16, Ht=0.15,
Fis=0.23, Fit=0.35, Fst=0.11) of the dark European honeybees A. m.
mellifera have calculated based on a polymorphism of the 9
microsatellite loci of the nuclear genome.
An analysis of the polymorphisms of the 9 microsatellite loci of the
nuclear genome and of the locus COI-COII of mitochondrial DNA allows to
determine the level of introgression of “southern” genes in
populations of the dark European honeybees in the Urals and Volga
regions. The hybridization process of A. m. mellifera occurred as a
result of introduction of the honeybee’s subspecies from the
Southern regions of Russia.
The selection method of the dark European honeybees with introgression
at most 5% and on the basis of the genetic parameters of the purebred
colonies of A. m. mellifera (Ho ≤ 0.30, Hs ≤ 0.30, Ht ≤ 0.30,
Fis ≤ │0.45│, Fit ≤ │0.55│, Fst ≥ │0.11│) have proposed based
on the polymorphisms of the 9 microsatellite loci of the nuclear
genome. The quality of the selection of honeybees can be determined by
number of genetic parameters which corresponded the testing colonies to
the parameters for selection above. Such genetic selection allows to
save genetic and genotypic diversity in populations within the genetic
standard of the subspecies A. m. mellifera.
|
204.
Ильясов Р.А. Генетическая структура популяции и филогенетическое
положение темной лесной пчелы Apis mellifera mellifera L. Урала и
Поволжья. Автореферат диссертации на соискание ученой степени доктора
биологических наук. Уфа. 2016. 48 с.
Ильясов Р.А. Генетическая структура популяции и филогенетическое
положение темной лесной пчелы Apis mellifera mellifera L. Урала и
Поволжья. Автореферат диссертации на соискание ученой степени доктора
биологических наук. Уфа. 2016. 48 с. (Ilyasov R.A. The genetic
structure of population and phylogenetic position of the dark European
bees Apis mellifera mellifera L. in the Urals and Volga region.
Abstract of dissertation for the degree of Doctor of Biological
Sciences. Ufa. 2016. P. 48.). На основе сравнительного анализа
нуклеотидных последовательностей генов ядерного и митохондриального
геномов была выявлена высокая информативность для филогенетических
реконструкций 7 генов мтДHK (ND2, ND4, ND4L, ND5, ND6, COI, COIII) и
гена вителлогенина VG яДHK медоносной пчелы.
В результате сравнительного анализа нуклеотидных последовательностей
локуса COI-COII мтДHK было показано, что уральская и поволжская
популяции темной лесной пчелы отличаются от европейских популяций A. m.
mellifera по SNP 912 G>A относительно референсной последовательности
Nc001566 в Генбанке.
Обнаружены SNPs митохондриального (SNP 816 C>T в гене ND2 мтДHK
относительно референсной последовательности Nc001566) и ядерного (22
SNPs и 2 двойные SNPs 2887-2888 AA>TC и 4508-4509 GG>AA в гене VG
яДHK относительно референсной последовательности Nс007073) геномов,
позволяющие проводить селекцию темной лесной пчелы A. m. mellifera.
Подтверждено вхождение в эволюционную ветвь М и тесное генетическое
родство темной лесной пчелы уральской популяции с европейскими
популяциями A. m. mellifera на основе сравнительного анализа
нуклеотидной последовательности гена VG яДHK, гена ND2 мтДHK и локуса
COI-COII мтДHK.
На основе геногеографического анализа интрогрессии “южных”
генов по ядерному (9 микросателлитных локусов) и митохондриальному
(локус COI-COII) геномам на Урале и в Поволжье обнаружены и
локализованы ареалы пяти сохранившихся популяций (резерватов) темной
лесной пчелы A. m. mellifera (бурзянская, татышлинская,
южно-прикамская, вишерская, камбарская).
На основе анализа полиморфизма 9 микросателлитных локусов яДHK были
рассчитаны генетические стандарты для популяции (Ho=0.24, Hs=0.23,
Ht=0.28, Fis=0.06, Fit=0.14, Fst=0.17) и семьи (Ho=0.20, Hs=0.16,
Ht=0.15, Fis=0.23, Fit=0.35, Fst=0.11) темной лесной пчелы A. m.
mellifera.
Анализ полиморфизма 9 микросателлитных локусов яДHK и локуса COI-COII
мтДHK позволил определить уровень интрогрессии “южных”
генов в популяции темной лесной пчелы Урала и Поволжья. Процесс
гибридизации A. m. mellifera происходил в результате интродукции
пчелиных семей других подвидов из южных регионов России.
На основе полиморфизма 9 микросателлитных локусов яДHK была предложена
методика селекции семей темной лесной пчелы с интрогрессией
“южных” генов не более 5%, и генетическими показателями,
характерными для чистопородных семей A. m. mellifera (Ho ≤ 0.30, Hs
≤ 0.30, Ht ≤ 0.30, Fis ≤ │0.45│, Fit ≤ │0.55│, Fst ≥
│0.11│). Качество селектируемого материала будет определяться числом
показателей, которым соответствует анализируемая семья пчел. Такая
селекция позволит поддерживать генетическое и генотипическое
разнообразие в рамках генетического стандарта подвида A. m. mellifera.
The high informativeness of the seven mitochondrial genes (ND2, ND4,
ND4L, ND5, ND6, COI, COIII) and the gene vitellogenin VG for
phylogenetic reconstructions of honeybees have found based on
comparative analysis of the nucleotide sequences.
The populations of the dark European honeybees of the Urals and Volga
region differ from the European populations of the A. m. mellifera by
SNP 912 G>A relative to the reference sequence Nc001566 have showed
based on a comparative analysis of the nucleotide sequences of the
locus COI-COII of the mitochondrial DNA.
The SNPs of the mitochondrial DNA (SNP 816 C> T in the ND2 gene of
mtDNA relative to the reference sequence Nc001566) and nuclear DNA (22
SNPs and 2 double SNPs 2887-2888 AA> TC and 4508-4509 GG> AA in
the VG gene of the nuclear DNA relative to the reference sequence
Nc007073) which allows to select the dark European honeybees A. m.
mellifera have found based on a comparative analysis of the nucleotide
sequences.
An including to the M evolutionary lineage of Apis mellifera and a
close genetic relationship of the dark European honeybees of the Ural
and Volga region populations with European populations have confirmed
based on a comparative analysis of the nucleotide sequences of the gene
vitellogenin VG of the nuclear DNA, of the locus COI-COII and the gene
ND2 of the mitochondrial DNA.
An area of the five preserved populations (reserves) of the dark
European honeybees A. m. mellifera (named burzyanskaya, tatyshlinskaya,
yuzhno-prikamskaya, visherskaya, kambarskaya) have found and localized
based on gene geographic analysis of the introgression of
“southern” genes of nuclear (9 microsatellite loci) and
mitochondrial (COI-COII locus) in the the Urals and Volga region.
The genetic standards of populations (Ho=0.24, Hs=0.23, Ht=0.28,
Fis=0.06, Fit=0.14, Fst=0.17) and colonies (Ho=0.20, Hs=0.16, Ht=0.15,
Fis=0.23, Fit=0.35, Fst=0.11) of the dark European honeybees A. m.
mellifera have calculated based on a polymorphism of the 9
microsatellite loci of the nuclear genome.
An analysis of the polymorphisms of the 9 microsatellite loci of the
nuclear genome and of the locus COI-COII of mitochondrial DNA allows to
determine the level of introgression of “southern” genes in
populations of the dark European honeybees in the Urals and Volga
regions. The hybridization process of A. m. mellifera occurred as a
result of introduction of the honeybee’s subspecies from the
Southern regions of Russia.
The selection method of the dark European honeybees with introgression
at most 5% and on the basis of the genetic parameters of the purebred
colonies of A. m. mellifera (Ho ≤ 0.30, Hs ≤ 0.30, Ht ≤ 0.30,
Fis ≤ │0.45│, Fit ≤ │0.55│, Fst ≥ │0.11│) have proposed based
on the polymorphisms of the 9 microsatellite loci of the nuclear
genome. The quality of the selection of honeybees can be determined by
number of genetic parameters which corresponded the testing colonies to
the parameters for selection above. Such genetic selection allows to
save genetic and genotypic diversity in populations within the genetic
standard of the subspecies A. m. mellifera. |
203.
Ильясов Р.А. Поскряков А.В. Николенко А.Г. Мониторинг (2004-2015 годы)
генофонда темной лесной пчелы бурзянской популяции Apis mellifera
mellifera. В сборнике научных трудов: Изучение природы Башкортостана и
проблемы пчеловодства. - Вып. 5 / Под ред. Н.М. Сайфуллиной. - Уфа:
Информреклама. 2016. - С. 148-161. 244 с.
Ильясов Р.А. Поскряков А.В. Николенко А.Г. Мониторинг (2004-2015 годы)
генофонда темной лесной пчелы бурзянской популяции Apis mellifera
mellifera. В сборнике научных трудов: Изучение природы Башкортостана и
проблемы пчеловодства. - Вып. 5 / Под ред. Н.М. Сайфуллиной. - Уфа:
Информреклама. 2016. - С. 148-161. 244 с. (Ilyasov R.A., Poskryakov
A.V., Nikolenko A.G. Monitoring (2004 - 2015 years) of the gene pool of
the burzyan population of dark forest bee A. m. mellifera. In the
procedings: Investigation of the Bashkortostan nature and the
challenges of the beekeeping. Editor: N.M. Saifullina. Ufa:
Informreklama. 2016. V. 5. - P. 148-161. 244 p.). АННОТАЦИЯ. Проведен
мониторинг генофонда популяции темной лесной пчелы Бурзянского района
Республики Башкортостан с 2004 по 2015 годы на основе изучения
полиморфизма 9 микросателлитных локусов яДНК. Выполнена оценка уровня
интрогрессии «южных» генов по годам и по отдельным выборкам
для разных годов исследований. Показана высокая стабильность и чистота
генофонда популяции темной лесной пчелы Бурзянского района со средним
уровнем интрогрессии «южных» генов 2,7%. Представлена
высокая эффективность сохранения чистоты генофонда A. m. mellifera на
территории природоохранных организаций - заповедников, национальных
парков и заказников. ABSTRACT. Monitoring of the gene pool of the dark
forest bee population of the Burzyansky district of the Republic of
Bashkortostan was performed from 2004 to 2015 based on the study of a
polymorphism of 9 microsatellite loci of the nuclear DNA. The level of
«southern» genes introgression for samples by years and for
every samples researches in different years was evaluated. The high
stability and purity of the gene pool of a of dark forest bees
population of the Burzyansky district with average level of
introgression of «southern» genes 2,7% was shown. The high
efficiency of the conservation of the gene pool purity of the A. m.
mellifera on the territory of a preserving nature organizations -
reserves, national parks and sanctuaries. |
202.
Ильясов Р.А. Поскряков А.В. Николенко А.Г. Генетический стандарт темной
лесной пчелы Apis mellifera mellifera для селекции. В сборнике научных
трудов: Изучение природы Башкортостана и проблемы пчеловодства. - Вып.
5 / Под ред. Н.М. Сайфуллиной. - Уфа: Информреклама. 2016. - С.
136-148. 244 с.
Ильясов Р.А. Поскряков А.В. Николенко А.Г. Генетический стандарт темной
лесной пчелы Apis mellifera mellifera для селекции. В сборнике научных
трудов: Изучение природы Башкортостана и проблемы пчеловодства. - Вып.
5 / Под ред. Н.М. Сайфуллиной. - Уфа: Информреклама. 2016. - С.
136-148. 244 с. (Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Genetic
standard for a selection of the dark forest bee A. m. mellifera. In the
procedings: Investigation of the Bashkortostan nature and the
challenges of the beekeeping. Editor: N.M. Saifullina. Ufa:
Informreklama. 2016. V. 5. - P. 148-161. 244 p.). АННОТАЦИЯ.В статье
нами представлен молекулярно-генетический анализ популяций и семей
темной лесной пчелы A. m. mellifera Урала и Поволжья в сравнении с
популяциями пчел «южных» подвидов A. m. caucasica и A. m.
carpatica Кавказа и Карпат на основе полиморфизма 9 микросателлитных
локусов яДHK. Нами получены генетические характеристики для популяции
(Ho=0,24, Hs=0,23, Ht=0,28, Fis=0,06, Fit=0,14, Fst=0,17) и семьи
(Ho=0,20, Hs=0,16, Ht=0,15, Fis=0,23, Fit=0,35, Fst=0,11) темной лесной
пчелы A. m. mellifera и предложена методика селекции семей темной
лесной пчелы с интрогрессией “южных” генов не более 5%, и
генетическими показателями, характерными для чистопородных семей A. m.
mellifera (Ho ≤ 0,30, Hs ≤ 0,30, Ht ≤ 0,30, Fis ≤ │0,45│,
Fit ≤ │0,55│, Fst ≥ │0,11│).Abstract. In this article we have
carried out a molecular genetic analysis of the populations and
colonies of the dark forest bee A. m. mellifera from the Urals and the
Volga region in comparison with populations of the bees of
“southern” subspecies A. m. caucasica and A. m. carpatica
from the Caucasus and the Carpathians based on the polymorphism 9
microsatellite loci of the nuclear DNA. We was proposed in this article
the genetic characteristics of the population (Ho=0,24, Hs=0,23,
Ht=0,28, Fis=0,06, Fit=0,14, Fst=0,17) and the colony (Ho=0,20,
Hs=0,16, Ht=0,15, Fis=0,23, Fit=0,35, Fst=0,11) of the dark forest bee
A. m. mellifera were calculated and the method of selection of the dark
forest bee colonies with introgression of "southern" less than 5% and
genetic characteristic of thoroughbred colonies A. m. mellifera (Ho
≤ 0,30, Hs ≤ 0,30, Ht ≤ 0,30, Fis ≤ │0,45│, Fit ≤
│0,55│, Fst ≥ │0,11│). |
201.
Ilyasov R. A., Kosarev M. N., Neal A., Yumaguzhin F. G. The Burzyan
wild-hive honeybee A.m.mellifera in the South Urals. Bee Improvement
and Conservation. 2016. V. 47. P. 6-8.
The Burzyan wild-hive honeybee A.m.mellifera in the South Urals
(Бурзянская бортевая пчела A.m.mellifera на Южном Урале)
Ilyasov R. A., Kosarev M. N., Neal A., Yumaguzhin F. G. The Burzyan
wild-hive honeybee A.m.mellifera in the South Urals. Bee Improvement
and Conservation. 2016. V. 47. P. 6-8.
When the number of natural tree cavities declined sharply, beekeepers
were forced to carfully treat the wild-hive bees more carefully. The
European dark bee Apis mellifera mellifera, a unique subspecies of
honeybee Apis mellifera, is evolutionar y adapted to live in the
continental climate of northern Eurasia with long cold winters.
Nowadays this subspecies survives only in a few isolated reservation
areas. The biggest areas are in Russia: about 300.000 colonies avoided
spontaneous hybridisation in the South Ural area of Republic of
Bashkirostan; about 200.000 colonies in the Middle Ural area and about
250.000 colonies in Volga region of Republic of Tatarstan. We also have
information about large populations of the European dark bee in the
Altai region of the Republic of Udmurtia. About 99% of European dark
bees in the South Urals are kept in framed hives in apiaries (Fig. 1),
and about 196 in natural and artificial tree cavities.
The evolution of European dark bees was synchronous with the evolution
of the widely spreading lime tree Tilia cordata and therefore the main
forage crop for these bees is when these trees blossom (Fig. 2).
Scientists of the Biochemical Insects Adaptation Laboratory in the Ufa
Scientific Centre of the Russian Academy of Science have been
monitoring the gene pool of the Burzyan honeybees for the last 20 years
using the polymorphism of loci COI-COII of mtDNA and microsatellite
loci ap243 and 4a l 1 0 of nuclear DNA. This extensive research
confirmed the pureness of the gene pool and that this gene pool is of
the subspecies A. m. mellifera.
In 2011, at the request of the Institute of Beekeeping and the
ShulganTash State Reserve, bees from this population were classified as
a sepa rate breed: the «Burzyan wild-hive bee». This breed
was registered under patent No.5956 in 14.06.2011 by the State
Commission of the Russian Federation in the state register.
According to artefacts found at the burial site of the Bahmutin culture
near Birsk, beekeeping in the southern Urals started no later than the
5th-6th centuries ВС among local Finno-Ugric tribes. Later, beekeeping
was adopted by ancestors of the Bashkirs, who assimilated or drove away
the Bahmutin people.
Beekeeping could be practised without iron tools and the skills
accumulated were passed on by many generations of tree-cavity
beekeepers (Fig. 3).
Bashkir beekeeping flourished in the 18th century, it took longer to
develop than in Germany, Poland, Lithuania, Belarus and central regions
of Russia, but they had a more perfect, convenient and reliable set of
tools and accessories. With special land tenure rights, the Bashkirs
could avoid compliance with the requirements of the Forest Service in
Russia, which in 1 882 had banned beekeeping in state forests as a
source of forest fires.
In 1 9th century due to deforestatio and the destruction of the
cultural traditions by the migrant population Bashkir beekeepers
developed «koloda» beekeeping. A «koloda» is
man-made cavity within a section of tree trunk (Fig. 3b), which could
be fixed high on a tree. Trees with kolodas were considered by Bashkir
as personal property and were marked with tamga» - a distinctive
sign of tribal affiliation (Fig. 4).
Every beekeeper knew his mark and did not touch the property of others,
and these trees with kolodas and tamgas were traditionally kept by a
family for generations.
In the second half of the 20th century Bashkir beekeepers started using
movable-frame hives, which gave rise to modern beekeeping.
Despite its hard labour and low productivity, tree-cavity apiculture in
remote areas of the South Urals still continues. Inspections of hollow
tree hive bees require work as high as 1 6 metres, and because they are
located away from populated areas, the beekeeper has to travel on
horseback a distance of 40-50 km per day (Fig. 5).
The tools used by Bashkir beekeepers are mostly homemade but are
similar to tools used in other countries. Tools unique to the Bashkir
wild-hive beekeepers are the «kiram» and the
«lange». A «kiram» is a braided leather belt up
to five metres in length for climbing up a tree. A «lange»
is a smal l portable platform or footrest (Fig. 5c), which is fixed on
the trunk with a rope.
In previous centuries, when there were enough natural cavities in the
trees with bees, Bashkirs, like beekeepers around the world, took all
the honey from the colony in the autumn, and the bees were left without
reserves and died. In spring, beekeepers would check these tree
cavities, clean them and make them ready for a new occupants in the
form of swarms. This «colonykilling» system was used until
the 1 9th century and in some areas until the 1950's. The advantages of
this system were that a new comb was created every year, the tree
cavities rotted less and, as a result, bees were rarely sick, their
body size did not decrease, and there was no inbreeding or
degeneration.
When the number of natural tree cavities declined sharply, beekeepers
were forced to carefully treat the wild-hive bees more carefully and
for the best colonies, to leave a sufficient amount of honey for the
winter. As a result, colonies were able to live a long time in the same
place - up to 1 8-25 years! Also, the beekeepers had to learn how to
replace a comb and the life of the cavities was reduced.
Wild-hive bees in the Ural area also have many natural enemies that
weaken the colony and cause their death. These are: brown bears Ursus
arctos, pine martens Martes martes, forest mice Apodemus uralensis,
great spotted woodpeckers Dendrocopos major, european bee-eaters Merops
apiaster, greater wax moths Calleria mellonella, european hornets Vespa
crabro, red wood ants Formica rufa, and red wasps Dolichovespula rufa.
They also have not avoided modern honey bee diseases and parasites,
such as varroa mites Varroa destructor, nosema Nosema apis, chalkbrood
disease Ascosphaerosis, American foulbrood Paenibacillus larvae, and
European foulbrood Melissococcus pluton. These are however more severe
in modern, movable-frame hives than in treecavity hives. The population
of treecavity bees has cyclical swings dependent on solar activity.
Currently, dark European bees exist in the southern Urals in the
ShulganTash State Reserve where they live in natural and man-made tree
cavities.
The Reserve was established in 1 958 and it covers an area of about
54.000 acres. The bees also live in the regional Altyn Solok Nature
Reserve (an area of 222.000 acres, established in 1997), and the
Bashkiria National Park (an area of 203.000 acres, formed in 1986).
At the end of 2014, these three national parks had about 1.200 trees
with «koloda» handmade tree-cavity hives, but only 300 of
them had bees. About 4.000 colonies were kept in apiaries with modern
movable-frame hives and 200-400' colonies lived in natural tree
cavities.
In 201 2, these Reserves were listed as especially protected areas,
together with a number of others, and acquired the status of a
biosphere by UNESCO called the «Bashkir Ural» complex with
a total area of 855 thousand acres. The regional Altyn Solok Reserve is
also protected by the Ministry of Environment of the Republic of
Bashkortostan. Currently, in order to preserve the Burzyan honey bee,
it is planned to expand the Shulgan-Tash Reserve in a north-westerly
direction through undeveloped territory between the rivers Nugush and
Uruk.
The staff from Shulgan-Tash, Altyn Solok and the Bashkiria National
Park, together with local beekeepers, are constantly taking measures to
increase the bee population and carry on selection work to improve the
immunity, winter hardiness and productivity of the Burzyan bees.
This policy of state-protected reservations allows us to save a unique
population of these A. m. mellifera bees in Eurasia in the face of new
threats of spontaneous hybridization and habitat destruction. |
200.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Новый подход к селекции
семей темной лесной пчелы A. m. mellifera по генетическим
характеристикам // Биомика. 2016. Т.8. №3. С. 208-214 (Ilyasov R.A.,
Poskryakov A.V., Nikolenko A.G. New approach to the selection of the
dark forest bee colonies A. m. mellifera on genetic characteristics
(translation). Biomics. 2016. V. 8. No. 3. P. 208-214.).
Новый подход к селекции семей темной лесной пчелы A. m. mellifera по
генетическим характеристикам (New approach to the selection of the dark
forest bee colonies A. m. mellifera on genetic characteristics)
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Новый подход к селекции
семей темной лесной пчелы A. m. mellifera по генетическим
характеристикам // Биомика. 2016. Т.8. №3. С. 208-214 (Ilyasov R.A.,
Poskryakov A.V., Nikolenko A.G. New approach to the selection of the
dark forest bee colonies A. m. mellifera on genetic characteristics
(translation). Biomics. 2016. V. 8. No. 3. P. 208-214.).
Аннотация. В статье нами представлен молекулярно-генетический анализ
популяций и семей темной лесной пчелы A. m. mellifera Урала и Поволжья
в сравнении с популяциями пчел «южных» подвидов A. m.
caucasica и A. m. carpatica Кавказа и Карпат на основе полиморфизма 9
микросателлитных локусов яДHK. Нами получены генетические
характеристики для популяции (Ho=0,24, Hs=0,23, Ht=0,28, Fis=0,06,
Fit=0,14, Fst=0,17) и семьи (Ho=0,20, Hs=0,16, Ht=0,15, Fis=0,23,
Fit=0,35, Fst=0,11) темной лесной пчелы A. m. mellifera и предложена
методика селекции семей темной лесной пчелы с интрогрессией
“южных” генов не более 5%, и генетическими показателями,
характерными для чистопородных семей A. m. mellifera (Ho ≤ 0,30, Hs
≤ 0,30, Ht ≤ 0,30, Fis ≤ │0,45│, Fit ≤ │0,55│, Fst ≥
│0,11│).
Abstract. In this article we have carried out a molecular genetic
analysis of the populations and colonies of the dark forest bee A. m.
mellifera from the Urals and the Volga region in comparison with
populations of the bees of “southern” subspecies A. m.
caucasica and A. m. carpatica from the Caucasus and the Carpathians
based on the polymorphism 9 microsatellite loci of the nuclear DNA. We
was proposed in this article the genetic characteristics of the
population (Ho=0,24, Hs=0,23, Ht=0,28, Fis=0,06, Fit=0,14, Fst=0,17)
and the colony (Ho=0,20, Hs=0,16, Ht=0,15, Fis=0,23, Fit=0,35,
Fst=0,11) of the dark forest bee A. m. mellifera were calculated and
the method of selection of the dark forest bee colonies with
introgression of "southern" less than 5% and genetic characteristic of
thoroughbred colonies A. m. mellifera (Ho ≤ 0,30, Hs ≤ 0,30, Ht
≤ 0,30, Fis ≤ │0,45│, Fit ≤ │0,55│, Fst ≥ │0,11│).
|
199.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Анализ генофонда
бурзянской популяции темной лесной пчелы A.m.mellifera L. // Биомика.
2016. Т.8. № 3. С. 200-207. (Ilyasov R.A., Poskryakov A.V., Nikolenko
A.G. Analysis of the gene pool of the burzyan population of dark forest
bee A. m. mellifera (translation). Biomics. 2016. V. 8. No. 3. P.
200-207.)
Анализ генофонда бурзянской популяции темной лесной пчелы A.m.mellifera
L. (Analysis of the gene pool of the Burzyan population of dark forest
bee A. m. mellifera L.)
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Анализ генофонда
бурзянской популяции темной лесной пчелы A.m.mellifera L. // Биомика.
2016. Т.8. № 3. С. 200-207. (Ilyasov R.A., Poskryakov A.V., Nikolenko
A.G. Analysis of the gene pool of the burzyan population of dark forest
bee A. m. mellifera (translation). Biomics. 2016. V. 8. No. 3. P.
200-207.)
Аннотация. Проведен мониторинг генофонда популяции темной лесной пчелы
Бурзянского района Республики Башкортостан в период с 2004 по 2015 гг.
на основе изучения полиморфизма 9 микросателлитных локусов яДНК.
Выполнена оценка уровня интрогрессии «южных» генов по годам
и по отдельным выборкам для разных годов исследований. Показана высокая
стабильность и чистота генофонда популяции темной лесной пчелы
Бурзянского района со средним уровнем интрогрессии «южных»
генов 2,7%. Представлена высокая эффективность сохранения чистоты
генофонда A. m. mellifera на территории природоохранных организаций -
заповедников, национальных парков и заказников.
Abstract. Monitoring of the gene pool of the dark forest bee population
of the Burzyansky district of the Republic of Bashkortostan was
performed from 2004 to 2015 based on the study of a polymorphism of 9
microsatellite loci of the nuclear DNA. The level of
«southern» genes introgression for samples by years and for
every samples researches in different years was evaluated. The high
stability and purity of the gene pool of a dark forest bees population
of the Burzyansky district with average level of introgression of
«southern» genes 2.7% was shown. The high efficiency of the
conservation of the gene pool purity of the A. m. mellifera on the
territory of a preserving nature organizations - reserves, national
parks and sanctuaries. |
198. Николенко А.Г., Гатауллин А.Р., Каскинова М.Д., Ильясов Р.А.
Генетическая структура уральской популяции темной лесной пчелы.
Материалы научно-практической конференции «Современное
пчеловодство. Проблемы разведения и селекции», посвященной
85-летию Научно-исследовательского института пчеловодства, 90-летию со
дня рождения Г.Д.Билаша, 70-летию со дня рождения Н.И.Кривцова. Рыбное:
ФГБНУ «НИИ пчеловодства», 18 сентября 2015 г. C. 42-45.
(Nikolenko A.G., Gataullin A.R., Kaskinova M.D., Ilyasov R.A. The
Genetic structure of the Ural population of the Dark European bees
(translated). Proceedings of the international scientific-practical
conference "Current beekeeping. Problems of breeding and
selection” 18 september 2016. Rybnoe: Institute of Beekeeping. P.
42-45). Генетическая структура уральской популяции темной лесной пчелы
(Genetic structure of the Ural population of the Dark European bees)
Николенко А.Г., Гатауллин А.Р., Каскинова М.Д., Ильясов Р.А.
Генетическая структура уральской популяции темной лесной пчелы.
Материалы научно-практической конференции «Современное
пчеловодство. Проблемы разведения и селекции», посвященной
85-летию Научно-исследовательского института пчеловодства, 90-летию со
дня рождения Г.Д.Билаша, 70-летию со дня рождения Н.И.Кривцова. Рыбное:
ФГБНУ «НИИ пчеловодства», 18 сентября 2015 г. C. 42-45.
(Nikolenko A.G., Gataullin A.R., Kaskinova M.D., Ilyasov R.A. The
genetic structure of the Ural population of the Dark European bees
(translated). Proceedings of the international scientific-practical
conference "Current beekeeping. Problems of breeding and
selection” 18 september 2015. Rybnoe: Institute of Beekeeping. P.
42-45). Проблема сохранения пород и их биоразнообразия особенно остро
ощущается в современном пчеловодстве. В США, после роста потерь
пчелиных семей с 15 до 30 % за зимний период в 2005-2008 гг. и
последующего короткого затишья, в 2014-2015 гг. было потеряно 40-50 %,
причем в 2015 г. потери в 27 % семей пришлись уже на летний период. В
России после 30 % потерь за зимовку 2002-2003 гг. официальная
статистика до последнего времени не велась. По данным нашего опроса,
выполненного в рамках исследований международной научной сети COLOSS,
потери пчелиных семей в России за зиму 2014/15 г. составили 20 %. Если
учесть, что пчелы в России слабо задействованы в интенсивных процессах,
аналогичных опылению миндаля в США или круглогодичному опылению теплиц
в Японии, эта величина потерь весьма велика.
На этом фоне активизируются научные исследования и практические
мероприятия по сохранению генофонда подвида темная лесная пчела Apis
mellifera mellifera L., обладающего повышенной природной устойчивостью
к ряду заболеваний и континентальному климату. В отсутствие
существенной государственной поддержки в России основной акцент нашего
проекта сделан на выделение сохранившихся локальных популяций этого
подвида и создание сети частных племенных пасек для расширенного
воспроизводства пчелиных семей и маток. Аналогичный подход реализуется
в Германии. В качестве обязательных дополнений разрабатываются четкая
внутривидовая систематика, эффективные методы идентификации генофонда
и, как программа максимум, изучаются перспективы селекции на миролюбие
и другие QTL.
Поиск и идентификация локальных популяций происходит на трех уровнях.
На первом собираются и, по возможности, географически локализуются все
упоминания о популяциях и экотипах темной лесной пчелы на территории
России и СНГ, а также работы систематиков, касающиеся подвидов
филогенетической линии М, таких как Apis daurica Fischer von Waldheim,
1843; A. m. mellifera natio tesquorum Skorikov, 1929; A. m. acervorum
Skorikov, 1929;A. m. silvarum Alpatov, 1935; A. m. taurica Alpatov,
1935 (крымская пчела); A. m. ussuriensis Lawrjochin, 1960
(дальневосточная пчела); A. m. artemisia Engel, 1999 (русская степная
пчела); A. m. sossimai Engel, 1999 (украинская пчела) и т.д.
В качестве второго слоя информации используются все доступные нам
точечные генетические оценки подвидовой принадлежности популяций
методами морфометрии, электрофореза изоферментов и ДНК-анализа, а также
экспертные оценки размеров популяций и их географической локализации.
Помимо идентификации популяций эти данные используются для расчетов
генетических расстояний между популяциями и последующего выделения
генетических резерватов, построения схем дальнеродственного
внутрипородного скрещивания. Хотя при сложившейся ситуации фактически
все сохранившиеся генетически чистые (чистопородные) популяции
приходится рассматривать как генетические резерваты.
В последние годы наблюдается планомерный переход от точечной
констатации факта существования популяций к планомерному
геногеографическому анализу (Miguel, 2007; Николенко др., 2010). На
третьем этапе наших исследований мы проводим детальный
геногеографический анализ для определения границ и структуры ареалов,
понимания генетических процессов и факторов, определяющих стабильность
генофондов, поиска оптимальных консервационных стратегий, формирования
изолированных или генетически пригодных мест (точков) для облета
(естественного осеменения) маток. Параллельно ведутся исследования для
создания сети частных, регулярно сертифицируемых племенных пасек,
занимающихся расширенным воспроизводством пчелиных семей и маток.
В начале геногеографических исследований нами была проведена оценка
информативности ряда микросателлитных локусов. В качестве рабочего
набора выбраны локусы Ap243, 4A110, A24, A8, A43, A113, A88, Ap049, и
A28. На основе полиморфизма микросателлитных локусов показано, что,
во-первых, все выборки из сохранившихся популяций Apis mellifera
mellifera имеют характерный и достаточно стабильный спектр частот
аллелей исследованных локусов. Во-вторых, этот спектр четко отличается
от аналогичных результатов для выборок из популяций Apis mellifera
caucasica и Apis mellifera carpatica. На основе полиморфизма
микросателлитных локусов и PLOT-анализа разработан метод для
количественной оценки степени гибридизации отдельно взятой пчелиной
семьи.
Общепринятый в мире диагностический метод рестрикционного анализа
(ПЦР-ПДРФ) локуса COI-COII мтДНК с использованием DraI
(Cornuet et al., 1993) не позволил нам найти какой-либо полиморфизм,
что подтверждает гипотезу исходного расселения темной лесной пчелы из
Западной Европы после последнего ледникового периода.Предполагаемые
рефугии существовали на средиземноморском побережье Франции (с меньшей
вероятностью в Испании). Низкий уровень рестрикционного полиморфизма
мтДНК в бурзянской популяции показал предпочтительность простого ПЦР
анализа, разработанного нами ранее.
В ходе анализа нуклеотидной последовательности межгенного локуса
COI-COII мтДНК проведен поиск новых митотипов линии М, как
потенциальных маркеров для идентификации и дифференциации Apis
mellifera mellifera. Выявлены новые, ранее не описанные митотипы класса
М, которые встречаются только на территории Урала и могут быть
использованы в качестве маркеров.
Предварительно определены границы и структура уральской популяционной
системы Apis mellifera melliferaпо ядерной и мтДНК. Наиболее детально
проведен геногеографический анализ бурзянской и мишкинской популяций.
Полученные результаты позволяют нам утверждать, что реальные
биологические популяции медоносной пчелы в России существуют.
Выделены центральная и периферическая зоны бурзянской популяции.
Показана высокая генетическая близость бортевых пчел и пасечных
пчелиных семей. Как показали наши исследования, общая численность
бурзянской популяции составляет не менее 7 тыс. чистопородных пчелиных
семей. Таким образом, это самая крупная из сохранившихся в мире
локальных популяций Apis mellifera mellifera. Ареал популяции не
совпадает с границами Бурзянского района, а охватывает горнолесные зоны
районов, прилегающих к нему, т.е. занимает значительную площадь,
протянувшуюся с севера на юг вдоль горных систем Южного Урала.
Проведен анализ генетических процессов, протекающих на границе
центральной и периферийной зон популяции, а также на границе
периферийной зоны популяции и гибридной зоны, выделены основные факторы
как определяющие стабильность генофонда, так и представляющие угрозу
для него. Особенно интенсивно генетические процессы протекают на стыке
периферии популяции и гибридной зоны. В первую очередь, это поток
генов, который до определенной степени уравновешивается отбором. Важную
роль в стабилизации генофонда популяции играют географическая изоляция
и трутневый фон (панмиксия), а также социальные факторы.
Вопреки существующей с XIX века парадигме о возможности сохранения
генофонда медоносной пчелы исключительно при разведении в форме
популяции закрытого типа показана возможность чистопородного сохранения
в масштабах локальной популяции без полной изоляции. Этот результат
может существенно упростить технологические проблемы, связанные с
искусственной изоляцией и последствиями инбридинга.
Новый метод статистического анализа данных позволил нам не только
получить точную оцифровку степени чистопородности, но и дал несколько
побочных, но очень ценных следствий. Одно из главных - объективная
интегральная оценка состояния генофонда в пределах любой площади, т.е.
возможность выделить не только районы чистопородного разведения
(популяции), но и разделить районы с гибридами как минимум на три
категории: зона M (периферийная зона популяции), где наличие гибридов
не препятствует чистопородному разведению темной лесной пчелы
(трутневый фон темной лесной, среднерусской пчелы сохраняется), зона С
- гибридизация зашла так далеко, что можно без опасения гибридизации с
темной лесной пчелой разводить южные породы, зона G - зона активной
гибридизации, где продолжается этот процесс, завозить туда любой
чистопородный материал бесперспективно без предварительного наведения
там порядка.
Полученные результаты свидетельствуют, что любая зона М и С независимо
от наличия гибридов пригодна для полноценного облета маток, но только
соответствующей породы, т.е. количество потенциальных облетников
больше, чем предполагалось. В РБ существуют большие по площади зоны С,
т.е. полноценный ареал разведения южных пород, а количество темной
лесной пчелы существенно меньше, чем считалось ранее. Размер бурзянской
популяции оказался куда меньше, чем нам казалось по результатам
предыдущего исследования.
Выявление зон М станет приоритетом наших исследований на ближайшее
время. В тех районах России, где предполагается наличие чистопородного
материала, мы предлагаем провести бесплатный мониторинг породности: по
5 семей с 4 пасек каждого населенного пункта. О возможности бесплатного
анализа породности можно сделать запрос в группе
https://vk.com/chestnaya_pchela или по e-mail: a-nikolenko@yandex.ru.
The results show that any zone of M and C, regardless of the presence
of hybrids, is suitable for a full flight of queens, but only for the
corresponding breed, i.e. The number of potential perennials is greater
than expected. In the Republic of Belarus, there are large areas of
area C, i.e. A full range of breeding southern breeds, and the number
of dark forest bees is much smaller than previously thought. The size
of the Burzyan population turned out to be much smaller than it seemed
to us from the results of the previous study.
The identification of M zones will be the priority of our studies for
the near future. In those regions of Russia where purebred material is
expected, we propose to conduct a free monitoring of the breed: 5
families from 4 apiaries of each settlement.
|
197. Ильясов Р.А., Поскряков А.В., Шарипов А.Я. Генетический потенциал
пчелиных семей бурзянской популяции. Материалы научно-практической
конференции «Современное пчеловодство. Проблемы разведения и
селекции», посвященной 85-летию Научно-исследовательского
института пчеловодства, 90-летию со дня рождения Г.Д.Билаша, 70-летию
со дня рождения Н.И.Кривцова. Рыбное: ФГБНУ «НИИ
пчеловодства», 18 сентября 2015 г. C. 35-41. (Ilyasov R.A.,
Poskryakov A.V., Sharipov A.Y. The genetic potential of the bee
colonies of the Burzyan population (translated). Proceedings of the
international scientific-practical conference "Current beekeeping.
Problems of breeding and selection” 18 september 2016. Rybnoe:
Institute of Beekeeping. P. 35-41). Генетический потенциал пчелиных
семей бурзянской популяции (The genetic potential of the bee colonies
of the Burzyan population)
Ильясов Р.А., Поскряков А.В., Шарипов А.Я. Генетический потенциал
пчелиных семей бурзянской популяции. Материалы научно-практической
конференции «Современное пчеловодство. Проблемы разведения и
селекции», посвященной 85-летию Научно-исследовательского
института пчеловодства, 90-летию со дня рождения Г.Д.Билаша, 70-летию
со дня рождения Н.И.Кривцова. Рыбное: ФГБНУ «НИИ
пчеловодства», 18 сентября 2015 г. C. 35-41. (Ilyasov R.A.,
Poskryakov A.V., Sharipov A.Y. The genetic potential of the bee
colonies of the Burzyan population (translated). Proceedings of the
international scientific-practical conference "Current beekeeping.
Problems of breeding and selection” 18 september 2015. Rybnoe:
Institute of Beekeeping. P. 35-41).
Сохранившиеся в чистоте популяции среднерусской пчелы (Apis mellifera
mellifera L.) приобрели особую значимость как ценный генетический
ресурс данной географической расы пчел [7]. Если всего 200 лет тому
назад эта пчела обитала на огромной территории Европы – от
Британских островов до Урала, то в начале XXI века ее чистые локальные
популяции сохранились только в виде небольших островков [2, 12].
Среди этих популяций максимально чистопородной считается бурзянская
бортевая пчела, обитающая в заповеднике «Шульган-Таш»
(Бурзянский район Республики Башкортостан) [8]. При этом местная пчела
уникальна тем, что часть семей обитает в искусственных и естественных
дуплах деревьев.
В настоящее время для заповедника «Шульган-Таш» стало
актуальным проведение селекции местных пчел с учетом генетического
потенциала отдельно взятых пчелиных семей. Согласно нашим
исследованиям, величинаинтрогрессии южных генов и уровень генетического
разнообразия пчелиных семей отражают генетический потенциал отдельно
взятой семьи.
Актуальность таких генетических исследований продиктована двумя
предпосылками: во-первых, в настоящее время в популяции бурзянской
пчелы проявляются следы метизации, интрогрессия южных генов в ней
достигает 2 % [3]. Причина общеизвестна – в последние годы
местная пчела все больше подвергается давлению южных пчел. Если до
1990-х годов ввоз на сопредельную территорию заповедника пчелиных семей
иной породной принадлежности не превышал 1 % от численности семей по
Бурзянскому району, то в начале XXI века его можно оценить в 2-3 % [6].
Во-вторых, мы считаем, что ульевые пчелы, живущие длительное время
относительно изолированно на пасеках под опекой человека, не могут
существовать постоянно в неизменном состоянии. У этих пчел в результате
искусственного отбора теряется генетическое разнообразие, накапливается
негативный генетический груз. По Р.А. Ильясову, для популяции пчел
характерен собственный оптимальный уровень генетического разнообразия:
его дефицит приводит к потере экологической пластичности и
адаптированности к окружающей среде, а избыток – к потере
сбалансированности генома [4].
Цель работы заключалась в изучении генетического потенциала пчелиных
семей, выражаемого через величиныинтрогрессии южных генов и
генетического разнообразия пчел.
Материал исследования.Работа проведена в 2015 г. В исследовании
использовано 48 рабочих особей от 12 пчелиных семей. Отобранные от
каждой пчелиной семьи по 4 живые пчелы фиксировались в 96 % этаноле и
хранились до выделения ДНК при –10 0С.
Для генетических исследований формированы 4 группы по 3 семьи в каждой
(табл. 1): 1 - пчелиные семьи в бортях – условно
«бортевые»; 2 - пчелиные семьи в рамочных ульях, у которых
пчелиные матки получены от бортевых пчелиных семей, переселенных в
рамочные ульи – «пасечно-бортевые»; 3 - пчелиные
семьи в рамочных ульях – «пасечные»; 4 - пчелиные
семьи в рамочных ульях, переведенные в разряд основных семей из
нуклеусов – «нуклеусы».
Методика исследований. Выводы сделаны на основе изучения полиморфизма
локусов ДНК: митохондриального (COI-COII) и ядерного (9 микросателлитов
– ap243, 4a110, A24, A8, A43, A113, A88, Ap049, A28).
Генетические исследования проводились лабораторией биохимии
адаптивности насекомых Института биохимии и генетики Уфимского научного
центра РАН по хоздоговорной теме (договор № 101 от 01.06.15).
Методика определения величины интрогрессии южных генов.Величина
интрогрессии южных генов определена по митохондральному геному и
ядерному геному ДНК. По митохондральному геному методика основана на
четких различиях вариантов локуса COI-COII у представителей
эволюционных ветвей М (темная лесная пчела) и С (южные пчелы) [5] (рис.
1).
Установлено, что варианты межгенного локуса COI-COII мтДНК PQ, PQQ,
PQQQ и PQQQQ встречаются только у темной лесной пчелы, вариант Q
– только у южных пчел [11]. Присутствие варианта Q указывает об
интрогрессии южных генов.
Уровень интрогрессии южных генов рассчитан на основе данных по
полиморфизму 9 микросателлитных локусов ядерного генома ap243, 4a110,
A24, A8, A43, A113, A88, Ap049, A28 с использованием программы
STRUCTURE 2.3.4 [14].
Рис. 1. Локализация межгенного локуса COI-COII мтДНК на кольцевой
митохондриальной ДНК медоносной пчелы A. m. mellifera и особенности ее
внутривидового полиморфизма(* - гены транспортной РНК)
Методика оценки генетического разнообразия пчел.По Р.А.Ильясову [4],
основу генетического разнообразия пчел составляет гетерозиготность,
поэтому оценка величины средней гетерозиготности по локусам ядерной ДНК
будет характеризовать уровень генетического разнообразия отдельно
взятой пчелиной семьи. В наших исследованиях средняя гетерозиготность
пчелиной семьи рассчитана на основе полиморфизма 9 микросателлитных
локусов ядерной ДНК.
Основанием такого утверждения является полиандрия – во время
брачного полета неплодная матка спаривается не с одним, а с 8-10 и
более неродственными трутнями [1]. Это вносит генетическое разнообразие
в популяцию рабочих особей пчелиной семьи, то есть в одной семье
одновременно присутствует потомство (пчелы) от разных трутней. Данное
явление проявляется в виде значительного генетического разнообразия
среди рабочих особей семьи.
Обсуждение результатов. Как видно из табл. 1, все рабочие особи
пчелиных семей являются носителями варианта PQQ локуса COI-COII –
это указывает на их происхождение по материнской линии от маток темной
лесной пчелы. Присутствие варианта Q локуса являлось бы показателем
южного происхождения семей по материнской линии от южных подвидов
A.m.caucasica, A.m.carnica, A.m.carpatica, A.m.ligustica [6].
Хотя по митохондриальному геному по полиморфизму локуса COI-COII
отобранные семьи пчел охарактеризованы как 100 %-ные темные лесные
пчелы, по ядерному геному по полиморфизму 9 микросателлитных локусов
нет такого однозначного 100 %-ного результата.
Ядерный геном ДНК показал уровень интрогрессии южных генов в отобранных
пчелиных семьях от 0,5 до 2,0 % (Куш-Елга-Баш 25-0,5 %, Куш-Елга-Баш
29-1,0 %, Капова Пещера 15-1,0 %, Капова Пещера 31-1,0 %, Байсалян
14-0,5 %).
Важно отметить, что южные гены выявлены только в пчелиных семьях,
живущих в условиях пасечного пчеловодства, а в пчелиных семьях, живущих
в условиях бортевого пчеловодства, а также в нуклеусах, вывезенных в
лес, нет (исключение составляет Байсалян 14, у которой содержание южных
генов составляет 0,5 %.) Факт наличия следов интрогрессии в пасечных
пчелах говорит о том, что давлению южных пчел, в первую очередь,
подвержены пчелиные семьи, содержащихся в рамочных ульях.
С целью оценки генетических взаимоотношений пчелиных семей рассчитаны
генетические дистанции М. Nei (1978) между пчелиными семьями на основе
данных полиморфизма 9 микросателлитных локусов. По значениям
генетических дистанций построена дендрограмма методом кластеризации
ближайшего соседа (Neighbourjoining) (NJ) (рис. 2).
Рис. 2. Дендрограмма генетических взаимоотношений пчелиных семей,
построенная методом ближайшего соседа по генетическим расстояниям М.
Nei (1978) по результатам анализа полиморфизма 9 микросателлитных
локусов ap243, 4a110, A24, A8, A43, A113, A88, Ap049, A28.
Как видно из рис. 2, внутри кластера в первую подгруппу объединились
все чистопородные пчелиные семьи – бортевые пчелиные семьи,
Байсалян 1 и Байсалян 13 (эти нуклеусы сформированы под влиянием потока
генов бортевых трутней), Куш-Елга-Баш 7. Во вторую (Куш-Елга-Баш 25,
Куш-Елга-Баш 29, Капова Пещера 24 и Байсалян 14) и третью (Капова
Пещера 15, Капова Пещера 31) подгруппы вошли пчелиные семьи, где
содержание южных генов соответственно доходило до 1 и 2 %.
Считаем, что такая кластеризация пчелиных семей сформирована под
влиянием наличия следов интрогрессии южных генов – в подгруппах
наблюдается сближение семей со сходными уровнями интрогрессии. При этом
кластерный анализ не смог дифференцировать семью Байсалян 14 со следами
интрогрессии в 0,5 % от семьи Капова Пещера 24 с отсутствием
интрогрессии. Возможно, что величина интрогрессии в 0,5 % столь мала,
что практически не оказала влияния на оценку генетической дистанции.
По нашим данным, средняя гетерозиготность пчелиных семей варьирует от
0,12 до 0,40 (табл. 1). Для сравнения приводим данные
других авторов, которые вели свои исследования на уровне популяций.
Так, средняя гетерозиготность в популяциях A.m.iberiensis в Испании
составляет 0,43 – 0,47 [9], в популяциях A.m.ligustica в
Португалии: 0,22 – 0,29 [10], в популяциях A.m.mellifera в
Швейцарии, Норвегии и Франции: 0,37 – 0,58 [15], в популяциях
A.m.mellifera в Польше: 0,49 – 0,64 [13], в популяциях
A.m.mellifera в Башкортостане: 0,32 – 0,41 [5]. Мы можем
отметить, что уровень гетерозиготности семей пчел по сравнению с
аналогичными данными в популяциях ниже.
В наших исследованиях наибольшей средней гетерозиготностью
характеризуются пчелиные семьи Куш-Елга-Баш 7, Куш-Елга-Баш 25 (0,40 и
0,25), Капова Пещера 15, Капова Пещера 31 (0,35 и 0,25), Байсалян 14
(0,30), наименьшей – семьи Байсалян 1 (0,12). Пчелиные семьи,
живущие в бортях, имеют среднее значение гетерозиготности от 0,21 до
0,25. Вероятно, что обитание в условиях дикой природы в дуплах деревьев
создает благоприятные условия для сохранения пчелиных семей
A.m.mellifera с оптимальным генетическим разнообразием. Мы считаем, что
средний уровень гетерозиготности от 0,21 до 0,25, при отсутствии
интрогрессия южных генов, будет оптимальным значением генетического
разнообразия (соответственно и генетического потенциала) пчелиных семей
бурзянской популяции.
Если взять за основу эти данные, оптимальными для практической селекции
являются семьи Капова Пещера 24 и Байсалян 1 (условно - ее средняя
гетерозиготность составляет 0,20).
Выводы
1. По митохондриальному геному по полиморфизму локуса COI-COII
отобранные пчелиные семьи охарактеризованы как чистопородные семьи
пчел.
2. По ядерному геному по полиморфизму 9 микросателлитных локусов ap243,
4a110, A24, A8, A43, A113, A88, Ap049, A28 выявлены следы интрогрессии
южных генов от 0,5 до 2,0 %, при этом давлению южных пчел, в первую
очередь, подвержены пасечные пчелиные семьи.
3.Средняя гетерозиготность отобранных пчелиных семей варьирует от 0,12
до 0,40, бортевые пчелиные семьи имеют гетерозиготность от 0,21 до
0,25, вероятно, что средняя гетерозиготность бортевых пчелиных семей
является оптимальным значением генетического разнообразия пчел.
4. Считаем, что средний уровень гетерозиготности от 0,21 до 0,25
(оптимальное значение генетического разнообразия) при отсутствии
интрогрессия южных генов будет оптимальным значением генетического
потенциала пчелиных семей бурзянской популяции.
Conclusions
1. The honeybee colonies have haracterized purebred based on the
polymorphysm of COI-COII loci in the Burzyan bees.
2. The introgression of Southern genes calculated 0,21 to 0,25 in the
Burzyan bees based on 9 microsatellite loci ap243, 4a110, A24, A8, A43,
A113, A88, Ap049, A28. Most introgression detected in apiaries than
tree trunk hollow nesting bees population in the Burzyan.
3. The mean of heterozygosity is 0,12 to 0,40 in apiary living bees and
0,21 to 0,25 in tree trunk hollow nesting bees in the Burzyan. These
values of heterozygosity are optimal for dark bees.
4. The optimal level of the heterozygosity 0,21 to 0,25 in the absence
of the introgression of southern genes will be the best value of the
genetic potential of the bee colonies of the Burzyan population.
|
196. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Seven genes of
mitochondrial genome enabling differentiation of honeybee subspecies
Apis mellifera. Russian Journal of Genetics, 2016, V. 52, No. 10, P.
1062–1070. DOI: 10.1134/S1022795416090064.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Семь генов
митохондриального генома, позволяющие дифференцировать подвиды
медоносной пчелы Apis mellifera. Генетика. 2016. Т. 52. № 10. С.
1176–1184. (IF 0.446). DOI: 10.7868/S001667581609006X. (Ilyasov
R.A., Poskryakov A.V., Nikolenko A.G. Seven genes of mitochondrial
genome enabling differentiation of honeybee subspecies Apis mellifera.
Russian Journal of Genetics, 2016, V. 52, No. 10, P. 1062–1070.
DOI: 10.1134/S1022795416090064.)
On the basis of comparative sequence analysis of 12 honeybee
mitochondrial genes, seven genes enabling us to differentiate honeybees
subspecies of the A, M, C, O evolutionary lineages were found. Applying
comparative sequence analysis of ND2 gene mtDNA as an example on a
statistically valid sample size, we showed a high level of
differentiating ability of this gene and assumed that each of these
seven genes probably can be used for differentiation of the subspecies
within four evolutionary lineages.
Проведен сравнительный анализ нуклеотидных последовательностей 12 генов
митохондриального генома медоносной пчелы, на основании которого
удалось выделить семь генов, позволяющих дифференцировать подвиды пчел
эволюционных ветвей А, М, С, О. На примере использования сравнительного
анализа нуклеотидной последовательности гена ND2 мтДНК на статистически
значимом объеме выборки мы показали высокий уровень дифференцирующей
способности этого гена и высказали предположение о возможности
отдельного использования каждого из семи генов для дифференциации
подвидов четырех эволюционных ветвей. |
195. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Семь генов
митохондриального генома, позволяющие дифференцировать подвиды
медоносной пчелы Apis mellifera. Генетика. 2016. Т. 52. № 10. С.
1176–1184. (IF 0.446). DOI: 10.7868/S001667581609006X.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Семь генов
митохондриального генома, позволяющие дифференцировать подвиды
медоносной пчелы Apis mellifera. Генетика. 2016. Т. 52. № 10. С.
1176–1184. (IF 0.446). DOI: 10.7868/S001667581609006X. (Ilyasov
R.A., Poskryakov A.V., Nikolenko A.G. Seven genes of mitochondrial
genome enabling differentiation of honeybee subspecies Apis mellifera.
Russian Journal of Genetics, 2016, V. 52, No. 10, P. 1062–1070.
DOI: 10.1134/S1022795416090064.)
On the basis of comparative sequence analysis of 12 honeybee
mitochondrial genes, seven genes enabling us to differentiate honeybees
subspecies of the A, M, C, O evolutionary lineages were found. Applying
comparative sequence analysis of ND2 gene mtDNA as an example on a
statistically valid sample size, we showed a high level of
differentiating ability of this gene and assumed that each of these
seven genes probably can be used for differentiation of the subspecies
within four evolutionary lineages.
Проведен сравнительный анализ нуклеотидных последовательностей 12 генов
митохондриального генома медоносной пчелы, на основании которого
удалось выделить семь генов, позволяющих дифференцировать подвиды пчел
эволюционных ветвей А, М, С, О. На примере использования сравнительного
анализа нуклеотидной последовательности гена ND2 мтДНК на статистически
значимом объеме выборки мы показали высокий уровень дифференцирующей
способности этого гена и высказали предположение о возможности
отдельного использования каждого из семи генов для дифференциации
подвидов четырех эволюционных ветвей. |
194. Ilyasov R.A. Features of the honey bee Apis mellifera genome
versus fruit fly Drosophila melanogaster. Journal of Investigative
Genomics. 2016. V. 3 No. 2. P. 00044 (1-3). DOI:
10.15406/jig.2016.02.00044 (http://medcraveonline.com/JIG/JIG-03-00044.pdf
)
Ilyasov R.A. Features of the honey bee Apis mellifera genome versus
fruit fly Drosophila melanogaster. Journal of Investigative Genomics.
2016. V. 3 No. 2. P. 00044 (1-3). DOI: 10.15406/jig.2016.02.00044 (http://medcraveonline.com/JIG/JIG-03-00044.pdf
)
The analysis of the nuclear and the mitochondrial genomes of the honey
bee Apis mellifera in comparison with the well-annotated, finished
fruit fly Drosophila melanogaster genome was presented in this article.
The nuclear genome of the honey bee has about 245 millions b.p. which
distributed in 16 chromosomes and contains about 10 thousands genes.
The mitochondrial genome of the A. mellifera has about 16 thousands
b.p. which located in mitochondrion’s and contains 35 genes. The
nuclear genome of the fruit fly has about 144 millions b.p. which
distributed in 4 chromosomes and contains about 17 thousands genes. The
mitochondrial genome of the D. melanogaster has about 19 thousands
b.p., which located in mitochondrion’s and contains 37 genes.
Despite the full sequencing of the nuclear and the mitochondrial
genomes of the A. mellifera the function of several genes and loci of
A. mellifera are not disclosed fully. A comparative analysis of the
genomes of A. mellifera and D. melanogaster using bioinformatics
techniques allowed to reveal the features of the structure and function
of the honey bee A. mellifera genome. The genome of A. mellifera have
more similarity with the vertebrate genome than D. melanogaster. The
genome of A. mellifera contains less genes of the native immunity, of
detoxification enzymes, of cuticle proteins and taste receptors
compared with D. melanogaster. However, A. mellifera contains new genes
associated with olfactory receptors, the processing of pollen and
nectar, poison organs, wax glands, caste determination and labor
division which absent at D. melanogaster. Probably, this is due to the
ecology of bees and their social evolution.
|
194. Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Глава
5.13. Пять сохранившихся резерватов темной лесной пчелы Apis mellifera
mellifera Урала и Поволжья. В книге: Темная лесная пчела Apis mellifera
mellifera L. Республики Башкортостан / Ред. Р.А. Ильясов, А.Г.
Николенко, Н.М. Сайфуллина. Москва: Товарищество научных изданий КМК,
2016. С. 278-289. ISBN 978-5-9908416-0-4. 320 с., 20 вкл. (Ilyasov A.
Rustem, Poskryakov V. Alexandr, Petukhov V. Alexandr, Nikolenko G.
Alexei. Chapter 5.13. Five remaining reserves of the dark forest bees
Apis mellifera mellifera in the Urals and the Volga region. In: Ilyasov
R.A., Nikolenko A.G., Saifullina N.M. Dark forest bee Apis mellifera
mellifera L. of the Republic of Bashkortostan. R.A. Ilyasov, A.G.
Nikolenko, N.M. Saifullina (eds.). Moscow: KMK Scientific Press, 2016.
P. 278-289. ISBN 978-5-9908416-0-4. 320 p., 20 color inserts.)
Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Глава 5.13.
Пять сохранившихся резерватов темной лесной пчелы Apis mellifera
mellifera Урала и Поволжья. В книге: Темная лесная пчела Apis mellifera
mellifera L. Республики Башкортостан / Ред. Р.А. Ильясов, А.Г.
Николенко, Н.М. Сайфуллина. Москва: Товарищество научных изданий КМК,
2016. С. 278-289. ISBN 978-5-9908416-0-4. 320 с., 20 вкл. (Ilyasov A.
Rustem, Poskryakov V. Alexandr, Petukhov V. Alexandr, Nikolenko G.
Alexei. Chapter 5.13. Five remaining reserves of the dark forest bees
Apis mellifera mellifera in the Urals and the Volga region. In: Ilyasov
R.A., Nikolenko A.G., Saifullina N.M. Dark forest bee Apis mellifera
mellifera L. of the Republic of Bashkortostan. R.A. Ilyasov, A.G.
Nikolenko, N.M. Saifullina (eds.). Moscow: KMK Scientific Press, 2016.
P. 278-289. ISBN 978-5-9908416-0-4. 320 p., 20 color inserts.)
Для локальных популяций пчел Урала, Поволжья были рассчитаны доли генов
южных подвидов по ядерному и митохондриальному геномам (табл. 4).
Гистограмма (plot), построенная по данным полиморфизма микросателлитных
локусов, наглядно показывает сохранение ядерного генома темной лесной
пчелы A. m.mellifera в локальных популяциях Урала и Поволжья (рис. 1).
Минимальным уровнем интрогрессии южных генов по ядерному геному
характеризовались локальные популяции темной лесной пчелы Республики
Башкортостан (бурзянская, татышлинская, янаульская, балтачевская,
караидельская, мишкинская, кушнаренковская), Пермского края (ординская,
осинская, частинская, добрянская, красновишерская, юсьвенская,
нытвенская, усольская, уинская, пермская), Республики Удмуртия
(камбарская, можгинская, якшур-бодьинская, малопургинская), Республики
Татарстан (мамадышская), Республики Чувашия (чебоксарская), Кировской
области (кильмезская).
На основе попарных значений Fst между локальными популяциями темной
лесной пчелы A. m. mellifera Урала и Поволжья, полученных по
результатам анализа полиморфизма микросателлитных локусов, была
построена дендрограмма методом кластеризации ближайшего соседа, которая
подтверждает данные уровня интрогрессии по ядерному геному. Локальные
популяции пчел южных подвидов A. m. caucasica и A. m. carpatica Кавказа
и Карпат были использованы для сравнения в качестве внешней группы
(рис. 2).
На дендрограмме локальные популяции южных пчел Кавказа и Карпат четко
дифференцируются и располагаются отдельно (группа I). Локальные
популяции местных пчел Урала и Поволжья подразделяются на две группы II
и III. В группе III преобладают локальные популяции пчел Республики
Башкортостан, имеющие значительный уровень интрогрессии генов южных
подвидов эволюционной ветви С. Во группе II локальные популяции пчел
Урала и Поволжья подразделяются на две подгруппы II-1 и II-2. В
подгруппе II-1 представлены примерно поровну локальные популяции пчел
Урала и Поволжья, имеющие незначительный уровень интрогрессии генов
южных подвидов. В подгруппе II-2 преобладают локальные популяции темной
лесной пчелы Урала, характеризующиеся минимальным уровнем интрогрессии
генов южных подвидов.
Для проведения геногеографического анализа секторные диаграммы,
отражающие доли интрогрессии генов южных подвидов пчел эволюционной
ветви С в локальных популяциях темной лесной пчелы Урала и Поволжья
эволюционной ветви М, были расположены по местам их локализации на
географической карте (рис. 3).
На территории Урала и Поволжья гены темной лесной пчелы A. m. mellifera
сохранились не равномерно - наблюдается тенденция возрастания доли
генов эволюционной ветви М по ядерному и митохондриальному геномам с
юга на север. В южной части Урала и Поволжья наблюдается единственная
сохранившаяся в чистоте локальная популяция темной лесной пчелы -
бурзянская, которая находится под охраной заказника «Алтын
Солок», заповедника «Шульган-Таш» и национального
парка «Башкирия».
Исходя из пространственного распределения локальных популяций,
характеризующихся минимальной интрогрессией генов южных подвидов по
ядерному и митохондриальному геномам, нам удалось выделить на
территории Урала и Поволжья пять сохранившихся популяций (резерватов)
темной лесной пчелы A. m. mellifera: бурзянская, татышлинская,
южно-прикамская, вишерская и камбарская.
Эти популяции на данный момент характеризуются достаточной
численностью, стабильной и сбалансированной генетической и
генотипической структурой и небольшим отклонением в распределении
частот генотипов от равновесного распределения по Харди-Вайнбергу. Эти
пять популяций составляют основу современного генофонда темной лесной
пчелы A. m. mellifera Урала и Поволжья. Для успешного сохранения
выделенных нами пяти популяций темной лесной пчелы на территории Урала
и Поволжья необходимо проводить постоянный мониторинг и управлять их
генофондом в соответствии с принципами популяционной генетики.
For local populations of bees of the Urals, the Volga region were
calculated share of the southern subspecies of the genes on the nuclear
and mitochondrial genomes (Table. 4).
Histogram (the plot), built according to the polymorphism of
microsatellite loci, clearly shows the retention of the nuclear genome
of a dark forest bees A. m.mellifera in local populations of the Urals
and the Volga region (Fig. 1).
The minimum level of introgression southern genes nuclear genome
characterized local populations dark forest bee Republic of
Bashkortostan (Burzyan, tatyshlinskaya, YANAULSKY, baltachevskaya,
karaidelskaya, Mishkinskoye, Kushnarenkovsky), Perm Territory (Orda,
Osinskaya, chastinskaya Dobriansky, Krasnovishersk, yusvenskaya,
Nytvensky, Usolye , Uinskoye, Perm), Republic of Udmurtia (Kambarka,
Mozhginsky, Yakshur-Bodyinsky, Malopurginskiy), the Republic of
Tatarstan (Mamadysh), Republic of Chuvashia (Cheboksary), the Kirov
region (kilmezskaya).
On the basis of pairwise Fst values between the local populations of
the dark forest bees A. m. mellifera Urals and the Volga region,
obtained from the analysis of polymorphism of microsatellite loci was
constructed by clustering dendrogram nearest neighbor, which confirms
data introgression level nuclear genome. Local bee population of the
southern subspecies A. m. caucasica and A. m. carpatica Caucasus and
the Carpathians were used for comparison as an external group (Fig. 2).
In the dendrogram local populations of the southern Caucasus and
Carpathian bees clearly differentiated and are located separately
(group I). Local populations of native bees Urals and the Volga region
are divided into two groups II and III. In Group III is dominated by
the local bee population of the Republic of Bashkortostan, having a
significant level of introgression of genes southern subspecies
evolutionary branch C. In Group II, the local bee population of the
Urals and the Volga region are divided into two subgroups II-1 and
II-2. In the subgroup II-1 represented about equally local bee
population of the Urals and the Volga region, having a low level of
introgression of genes southern subspecies. In the subgroup II-2 is
dominated by local populations dark forest bees Urals, characterized by
a minimum level of introgression of genes of the southern subspecies.
For the genogeographical analysis pie charts, reflecting the proportion
of introgression of genes of the southern subspecies of bees
evolutionary branches with local populations in the dark forest bees
Urals and Volga evolutionary branches of M, were located in places of
their location on a map (Fig. 3).
On the territory of the Urals and the Volga region genes dark forest
bees A. m. mellifera not uniformly preserved - there is a tendency of
increasing the proportion of genes evolutionary branches of M on
nuclear and mitochondrial genomes from south to north. In the southern
part of the Urals and the Volga region there is only surviving local
population clean dark forest bee - Burzyan, which is under the
protection of the reserve "Altyn Solok" reserve "Shulgan-Tash" and the
national "Bashkiria" park.
Based on the spatial distribution of local populations, introgression
of genes characterized by a minimum of southern subspecies of nuclear
and mitochondrial genome, we were able to identify in the Urals and the
Volga region five surviving populations (reserves) dark forest bees A.
m. mellifera: Burzyan, tatyshlinskaya, South Prikamskaya, Visherskaya
and Kambarka.
This population is currently characterized by a sufficient number of
stable and balanced genetic and genotypic structure and a small
deviation in the distribution of genotype frequencies from the
equilibrium distribution of Hardy-Weinberg. These five populations are
the basis of modern gene pool of dark forest bees A. m. mellifera Urals
and the Volga region. To successfully save us five isolated populations
of a dark forest bees in the Urals and the Volga region it is necessary
to continuously monitor and control their gene pool in accordance with
the principles of population genetics.
|
193. Ильясов Р.А., Поскряков А.В., Салтыкова Е.С., Николенко А.Г. Глава
5.12. Диагностика темной лесной пчелы башкирской популяции на основе
полиморфизма гена вителлогенина VG. В книге: Темная лесная пчела Apis
mellifera mellifera L. Республики Башкортостан / Ред. Р.А. Ильясов,
А.Г. Николенко, Н.М. Сайфуллина. Москва: Товарищество научных изданий
КМК, 2016. С. 271-278. ISBN 978-5-9908416-0-4. 320 с., 20 вкл. (Ilyasov
A. Rustem, Poskryakov V. Alexandr, Saltykova S. Elena, Nikolenko G.
Alexei. Chapter 5.12. Identification of dark forest bees of the Bashkir
population, based on vitellogenin gene (VG) polymorphism. In: Ilyasov
R.A., Nikolenko A.G., Saifullina N.M. Dark forest bee Apis mellifera
mellifera L. of the Republic of Bashkortostan. R.A. Ilyasov, A.G.
Nikolenko, N.M. Saifullina (eds.). Moscow: KMK Scientific Press, 2016.
P. 271-278. ISBN 978-5-9908416-0-4. 320 p., 20 color inserts.)
Ильясов Р.А., Поскряков А.В., Салтыкова Е.С., Николенко А.Г. Глава
5.12. Диагностика темной лесной пчелы башкирской популяции на основе
полиморфизма гена вителлогенина VG. В книге: Темная лесная пчела Apis
mellifera mellifera L. Республики Башкортостан / Ред. Р.А. Ильясов,
А.Г. Николенко, Н.М. Сайфуллина. Москва: Товарищество научных изданий
КМК, 2016. С. 271-278. ISBN 978-5-9908416-0-4. 320 с., 20 вкл. (Ilyasov
A. Rustem, Poskryakov V. Alexandr, Saltykova S. Elena, Nikolenko G.
Alexei. Chapter 5.12. Identification of dark forest bees of the Bashkir
population, based on vitellogenin gene (VG) polymorphism. In: Ilyasov
R.A., Nikolenko A.G., Saifullina N.M. Dark forest bee Apis mellifera
mellifera L. of the Republic of Bashkortostan. R.A. Ilyasov, A.G.
Nikolenko, N.M. Saifullina (eds.). Moscow: KMK Scientific Press, 2016.
P. 271-278. ISBN 978-5-9908416-0-4. 320 p., 20 color inserts.)
Для исследования были отобраны 12 рабочих пчел из разных пчелиных семей
с пасек, расположенных в ареалах генетических изолятов подвида
A.m.mellifera: д. Кагарманово, с. Кага и с. Серменево Белорецкого
района, д. Галиакберово, д. Яумбаево и д. Иргизлы Бурзянского района,
д. Кустаревка, д. Сабанчи и д. Уядыбаш Татышлинского района Республики
Башкортостан (Республики Башкортостан), д. Нытва Нытвенского района и
двух пасек в д. Поршакова Красновишерского района и с. Юсьва
Юсьвинского района Пермского края (ПК). Пчелы проверялись на
принадлежность к подвиду A.m.mellifera по структуре межгенного локуса
COI-COII мтДНК и спектрам аллелей 9 микросателлитных локусов: Ap243,
4a110, A24, A8, A43, A113, A88, Ap049 и A28 (Никоноров и др., 1998;
Николенко, Поскряков, 2002; Ильясов и др., 2007).
Обсуждениe. При сравнении просеквенированных нами нуклеотидных
последовательностей гена Vg пчел из Уральского региона с
последовательностями этого гена для пчел линии С, представленной в
GenBank, было обнаружено 26 SNP, которые четко дифференцировали
представителей двух эволюционных ветвей - М и С (табл. 3).
Эти SNP могут быть использованы в качестве генетических ядерных
маркеров для поиска сохранившихся изолятов A.m.mellifera в России в
условиях гибридизации с пчелиными семьями с Кавказа и из стран Средней
Азии и Восточной Европы.
Сравнительный анализ нуклеотидных последовательностей гена Vg пчел
эволюционных ветвей M и C (GenBank и наши данные) показал, что во 2-м
экзоне встречались три дифференцирующие эти линии позиции SNP, в 3-м
экзоне - 5, в 4-м экзоне - 5, в 5-м экзоне - 7, в 6-м экзоне - 6, в 7-м
экзоне - не встречались. Таким образом, по результатам анализа гена Vg
пчел эволюционных ветвей M и C были максимально информативны 5-й и 6-й
экзоны, среднеинформативны 2-й, 3-й и 4-й экзоны, и неинформативен 7-й
экзон.
На основе кластерного анализа в программе MEGA 4.1. методом объединения
ближайших соседей просеквенированных нами нуклеотидных
последовательностей гена Vg пчел из уральского региона и нуклеотидных
последовательностей пчел эволюционной ветви М (изоляты I2331, I2332,
I2341, I2342, I2481, I2482, I2561, I2562 из Испании и M2271 M2272 из
Польши), эволюционной ветви A (изоляты S2851, S2852, S2901, S2902,
S2981, S2982, S2991, S2992, S3001, S3002 из Южной Африки) и
эволюционной ветви С (изоляты C1811, C1812 из Германии, C2001, C2002 из
Хорватии, C2731, C2732 из Словении, L2321, L2322 из Египта) из GenBank
(Kent et al., 2011) была построена дендрограмма, наглядно отображающая
генетические взаимоотношения пчел разных эволюционных ветвей (рис. 2).
Все привлеченные к анализу нуклеотидные последовательности гена Vg
четко кластеризовались в три группы, соответствующие трем эволюционным
ветвям пчел: А (Африка), М (Урал и Западная Европа) и С (Ближний Восток
и страны Восточной Европы). Пчелы из Уральского региона
кластеризовались в одну группу с представителями западноевропейских
популяций эволюционной ветви М, что подтверждает их генетическую
близость. Пчелы двух изолятов из Южной Африки оказывались близки к
группе пчел эволюционной ветви С, что, возможно, связано с ошибочным
отнесением авторами по нуклеотидной последовательности гена Vg этих
гибридных пчел к эволюционной ветви А (Kent et al., 2011).
Таким образом, сравнительный анализ нуклеотидной последовательности
гена Vg может быть полезен в филогенетических реконструкциях
представителей вида A.mellifera, а обнаруженные 26 позиций SNP могут
использоваться в качестве генетических маркеров, дифференцирующих пчел
эволюционных ветвей М и С, в селекции чистых линий A.m.mellifera, в
проведении генетического штрихкодирования и создании генетического
паспорта семей.
For the study were selected 12 worker bees from different bee colonies
from apiaries located in the resorts of genetic isolates subspecies
A.m.mellifera: d Kagarmanova with.. And Kaga. Sermenevo Beloretsk
district, Galiakberova D., D. and D. Yaumbaevo Irgizly Burzyansky area
Kustarevka D., D. and D. Sabanci Uyadybash Tatyshlinsky District of the
Republic of Bashkortostan (RB), D. Nytva Nytvensky district and two
apiaries in D. Porshakova Krasnovishersky district and. Yusva Yusvinsky
District of Perm Krai (PC). Bees were tested belonging to a subspecies
Ammellifera structure intergenic locus COI-COII mtDNA alleles spectra
and 9 microsatellite loci: Ap243, 4a110, A24, A8, A43, A113, A88, Ap049
and A28 (Nikonorov et al, 1998; Nikolenko. Poskryakov, 2002; Ilyasov et
al, 2007)..
Discussion. When comparing the sequenced contact Vg gene nucleotide
sequences of the bees from the Ural region with the sequences of the
gene for the bees line C provided in the GenBank, 26 SNP was found that
clearly differentiated the representatives of the two evolutionary
branches - M and C (Table 3.).
These SNP may be used as genetic markers for nuclear research surviving
isolates A.m.mellifera in Russia in terms of hybridization with bee
families from the Caucasus and Central Asia and Eastern Europe.
Comparative analysis of nucleotide Vg gene sequences bees evolutionary
branch M and C (GenBank and our data) showed that in the 2nd exon met
three differentiating these lines SNP positions in the 3rd exon - 5 in
the 4th exon - 5 the 5th exon - 7, in exon 6 - 6 in the 7th exon - met.
Thus, the results of gene analysis bees Vg M and C evolutionary
branches were maximally informative 5th and 6th exons
sredneinformativny 2nd, 3rd and 4th exons and neinformativen 7th exon.
On the basis of cluster analysis in the program MEGA 4.1. by combining
immediate neighbors sequenced us nucleotide Vg gene sequences bees from
the Ural region and the nucleotide sequences of bees evolutionary
branches of M (isolates I2331, I2332, I2341, I2342, I2481, I2482,
I2561, I2562 from Spain and M2271 M2272 from Poland), the evolutionary
branch A (isolates S2851, S2852, S2901, S2902, S2981, S2982, S2991,
S2992, S3001, S3002 from South Africa) and the evolutionary branch C
(isolates C1811, C1812 from Germany, C2001, C2002 from Croatia, C2731,
C2732 from Slovenia, L2321 , L2322 from Egypt) from GenBank (Kent et
al., 2011) was constructed dendrogram clearly showing genetic
relationships bee different evolutionary branches (Fig. 2).
All involved in the analysis of the nucleotide sequence of Vg gene
clearly clustered into three groups corresponding to three evolutionary
branches Bee: A (Africa), M (the Urals and Western Europe) and C (the
Middle East and Eastern Europe). Bees from the Ural region clustered in
the same group with representatives of Western European populations
evolutionary branches M, which confirms their genetic proximity. Bees
two isolates from South Africa is close to a group of bees evolutionary
branch With that, perhaps due to the erroneous attribution sponsored by
the nucleotide sequence of the gene Vg these hybrid bees to the
evolutionary branch A (Kent et al., 2011).
Thus, the comparative analysis of the nucleotide sequence of Vg gene
may be useful in phylogenetic reconstructions of a species A.mellifera,
and the detected positions SNP 26 can be used as genetic markers of
differentiating bees evolutionary branch M and C, in the selection
Ammellifera clean lines to conduct genetic barcoding and the creation
of a genetic family passport.
|
192. Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Глава
5.11. Генетическая дифференциация уральской популяции темной лесной
пчелы. В книге: Темная лесная пчела Apis mellifera mellifera L.
Республики Башкортостан / Ред. Р.А. Ильясов, А.Г. Николенко, Н.М.
Сайфуллина. Москва: Товарищество научных изданий КМК, 2016. С. 263-270.
ISBN 978-5-9908416-0-4. 320 с., 20 вкл. (Ilyasov A. Rustem, Poskryakov
V. Alexandr, Petukhov V. Alexandr, Nikolenko G. Alexei. Chapter 5.11.
Genetic differentiation of the Ural population of the dark forest bees.
In: Ilyasov R.A., Nikolenko A.G., Saifullina N.M. Dark forest bee Apis
mellifera mellifera L. of the Republic of Bashkortostan. R.A. Ilyasov,
A.G. Nikolenko, N.M. Saifullina (eds.). Moscow: KMK Scientific Press,
2016. P. 263-270. ISBN 978-5-9908416-0-4. 320 p., 20 color inserts.)
Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Глава 5.11.
Генетическая дифференциация уральской популяции темной лесной пчелы. В
книге: Темная лесная пчела Apis mellifera mellifera L. Республики
Башкортостан / Ред. Р.А. Ильясов, А.Г. Николенко, Н.М. Сайфуллина.
Москва: Товарищество научных изданий КМК, 2016. С. 263-270. ISBN
978-5-9908416-0-4. 320 с., 20 вкл. (Ilyasov A. Rustem, Poskryakov V.
Alexandr, Petukhov V. Alexandr, Nikolenko G. Alexei. Chapter 5.11.
Genetic differentiation of the Ural population of the dark forest bees.
In: Ilyasov R.A., Nikolenko A.G., Saifullina N.M. Dark forest bee Apis
mellifera mellifera L. of the Republic of Bashkortostan. R.A. Ilyasov,
A.G. Nikolenko, N.M. Saifullina (eds.). Moscow: KMK Scientific Press,
2016. P. 263-270. ISBN 978-5-9908416-0-4. 320 p., 20 color inserts.)
Поиск сохранившихся островков популяции темной лесной пчелы
A.m.mellifera в Республике Башкортостан и Пермском крае был выполнен на
основе полиморфизма длин амплифицированных фрагментов локуса COI-COII
мтДНК, где более длинный фрагмент PQQ характеризует местных уральских
пчел A.m.mellifera, тогда как более короткий фрагмент Q - характеризует
интродуцированные южные подвиды пчел эволюционной ветви С.
Частоты вариантов PQQ и Q варьировали в сохранившихся островках
популяции темной лесной пчелы A.m.mellifera Республики Башкортостан и
Пермского края в пределах от 0.57 до 1.00 (табл. 1). Вишерская,
Татышлинская и Бурзянская популяции темной лесной пчелы A.m.mellifera
характеризовались очень высокой частотой варианта PQQ - 0.99, а
Южно-Прикамская популяция пчел - более низкой частотой 0.90. Высокая
частота варианта PQQ (≥ 0.90) позволяет сделать заключение об их
принадлежности к подвиду A.m.mellifera по материнской линии. Иглинская
популяция медоносной пчелы характеризовалась более низкой частотой
варианта PQQ - 0.57, что позволяет предположить о ее гибридизации с
интродуцированными южными подвидами пчел эволюционной ветви С.
Частоты аллелей двух микросателлитных локусов ap243 и 4a110
распределялись в сохранившихся островках популяции темной лесной пчелы
A.m.mellifera неравномерно (табл. 1). В популяции темной лесной пчелы
на Урале наиболее часто встречались аллели размером 254 п. н. и 257 п.
н. локуса ap243, и аллели размером 160 п. н. и 168 п. н. локуса 4a110.
Дендрограмма, визуализирующая генетические взаимоотношения всех
островков популяции темной лесной пчелы A.m.mellifera на Урале, была
построена в программе STATISTICA 8.0 на основе генетических расстояний
D (Nei, 1978) методом группировки ближайших соседей (Saitou, 1987)
(рис. 3).
На дендрограмме Иглинская популяция располагается отдельно от всех
остальных, которые, в свою очередь, группируются вместе. Такое
расположение свидетельствует о значительной генетической отдаленности
Иглинской популяции от других островков популяции темной лесной пчелы,
что, вероятно, является результатом гибридизации местных пчел с
интродуцированными южными подвидами эволюционной ветви С. Совместная
группировка остальных четырех островков популяции темной лесной пчелы
говорит об их генетическом родстве по ядерным локусам. Таким образом,
на дендрограмме четко выделяются четыре сохранившихся островка
популяции темной лесной пчелы A.m.mellifera: Вишерская,
Южно-Прикамская, Татышлинская и Бурзянская.
В результате проведенных генетических исследований на основе анализа
локусов митохондриальной ДНК (COI-COII мтДНК) и ядерной ДНК (два
микросателлитных локуса ap243 и 4a110) популяции темной лесной пчелы
A.m.mellifera на територии Урала - Республика Башкортостан (Южный Урал)
и Пермский край (Средний Урал) - нами были обнаружены четыре островка
сохранившейся популяции темной лесной пчелы: Вишерская,
Южно-Прикамская, Татышлинская и Бурзянская. Мы надеемся, что данные,
полученные в статье, позволят выполнить новые проекты по поиску новых
локализаций сохранившейся популяции темной лесной пчелы A.m.mellifera в
России и других странах. В дальнейшем мы планируем расширить число
анализируемых локусов и территорию исследований.
Search surviving dark forest bee populations Ammellifera islands in the
Republic of Bashkortostan and the Perm region was made on the basis of
the amplified fragment length polymorphism locus COI-COII mtDNA, where
the longer fragment PQQ characterizes the local Ural Ammellifera bees,
while a shorter fragment Q - characterizes introduced southern
subspecies of bees evolutionary branch C.
Frequency options PQQ and Q varied islets surviving population of a
dark forest bees A.m.mellifera the Republic of Bashkortostan and the
Perm Territory in the range of 0.57 to 1.00 (Table. 1). Visherskaya,
Tatyshlinskaya and Burzyan population A.m.mellifera dark forest bees
are characterized by very high frequency option PQQ - 0.99, and South
Prikamskaya population of bees - a lower incidence of 0.90. High
frequency option PQQ (≥ 0.90) allows us to conclude that they belong
to the subspecies A.m.mellifera through the maternal line. Iglinskiy
honeybee population is characterized by a lower frequency of PQQ
version - 0.57, suggesting that its hybridization with introduced
southern subspecies of bees evolutionary branch C.
The frequencies of alleles of two microsatellite loci ap243 and 4a110
are distributed in the remaining islands population A.m.mellifera dark
forest bees unevenly (Table. 1). In the dark forest bee population in
the Urals, the most frequent allele size 254 n. N. 257 and n. n. locus
ap243, and allele size 160 n. n. 168 and n. n. locus 4a110.
Dendrogram visualizing genetic relationship between all the islands
dark forest bee populations A.m.mellifera in the Urals, it was built in
the program STATISTICA 8.0 based on genetic distances D (Nei, 1978) by
grouping the nearest neighbors (Saitou, 1987) (Fig. 3).
On dendrogram Iglinskiy population located separately from all the
others who, in turn, are grouped together. Such an arrangement shows
significant genetic distance from other populations Iglinskiy islets
dark forest bee populations, which probably is a result of
hybridization with introduced native bees southern subspecies
evolutionary branch C. The joint group of the other four islands of
dark forest bee population speaks about their genetic relationship on
nuclear loci. Thus, in the dendrogram clearly distinguished four
remaining island population A.m.mellifera dark forest bees:
Visherskaya, South Prikamskaya, Tatyshlinskaya and Burzyan.
As a result of genetic research based on analysis of mitochondrial DNA
loci (COI-COII mtDNA) and nuclear DNA (microsatellite locus two ap243
and 4a110) population Ammellifera dark forest bee on the territory of
the Urals - the Republic of Bashkortostan (South Urals) and the Perm
region (the Middle Urals ) - we discovered four island dark forest bees
remaining population: Visherskaya, South Prikamskaya, Tatyshlinskaya
and Burzyan. We hope that the data obtained in this article will help
to fulfill new projects to find new locations remaining population
A.m.mellifera dark forest bees in Russia and other countries. In the
future we plan to expand the number of analyzed loci and area studies.
|
191. Ильясов Р.А., Шареева З.В., Николенко А.Г. Глава 5.10.
Генетическая структура северной башкирской популяции темной лесной
пчелы. В книге: Темная лесная пчела Apis mellifera mellifera L.
Республики Башкортостан / Ред. Р.А. Ильясов, А.Г. Николенко, Н.М.
Сайфуллина. Москва: Товарищество научных изданий КМК, 2016. С. 254-263.
ISBN 978-5-9908416-0-4. 320 с., 20 вкл. (Ilyasov A. Rustem, Shareeva V.
Zita, Nikolenko G. Alexei. Chapter 5.10. Genetic structure of of
northern population of native dark forest bees. In: Ilyasov R.A.,
Nikolenko A.G., Saifullina N.M. Dark forest bee Apis mellifera
mellifera L. of the Republic of Bashkortostan. R.A. Ilyasov, A.G.
Nikolenko, N.M. Saifullina (eds.). Moscow: KMK Scientific Press, 2016.
P. 254-263. ISBN 978-5-9908416-0-4. 320 p., 20 color inserts.)
Ильясов Р.А., Шареева З.В., Николенко А.Г. Глава 5.10. Генетическая
структура северной башкирской популяции темной лесной пчелы. В книге:
Темная лесная пчела Apis mellifera mellifera L. Республики Башкортостан
/ Ред. Р.А. Ильясов, А.Г. Николенко, Н.М. Сайфуллина. Москва:
Товарищество научных изданий КМК, 2016. С. 254-263. ISBN
978-5-9908416-0-4. 320 с., 20 вкл. (Ilyasov A. Rustem, Shareeva V.
Zita, Nikolenko G. Alexei. Chapter 5.10. Genetic structure of of
northern population of native dark forest bees. In: Ilyasov R.A.,
Nikolenko A.G., Saifullina N.M. Dark forest bee Apis mellifera
mellifera L. of the Republic of Bashkortostan. R.A. Ilyasov, A.G.
Nikolenko, N.M. Saifullina (eds.). Moscow: KMK Scientific Press, 2016.
P. 254-263. ISBN 978-5-9908416-0-4. 320 p., 20 color inserts.)
Целью исследований было изучение структуры популяции медоносной пчелы
северного ареала Республики Башкортостан в сравнительном
популяционно-генетическом аспекте.
По результатам морфометрических исследований в Бирском, Мишкинском и
Караидельском районах Республики Башкортостан 79% пасек были отнесены к
темной лесной пчеле подвида А.m.mellifera, 21% пасек - к пчелам
гибридного происхождения.
Данные морфометрических исследований полностью подтверждаются данными,
полученными на основе полиморфизма межгенного локуса COI-COII мтДНК и
результатам анализа вариабельности микросателлитных локусов ар243,
4а110 и А8 ядерной ДНК.
Результаты анализа полиморфизма межгенного локуса COI-COII мтДНК
показали, что частота встречаемости комбинации PQQ (табл. 1) у пчел
исследуемых районов варьировала от 0.00 (2 пасеки Бирского района - д.
Вязовка и д. Старобазаново; 4 пасеки Караидельского района - д. Тайкаш,
д. Байки-Юнусова и д. Новый Акбуляк) до 1.00 в абсолютном большинстве
изучаемых пасек.
Сопоставляя значения частот встречаемости комбинаций межгенного локуса
COI-COII мтДНК, исследуемые и сравниваемые выборки пчел можно
классифицировать следующим образом: пасеки со значениями частот PQ,
PQQ, PQQQ - 0.95-1.00 относить к чистопродным с высоким уровнем
содержания семей A.m.mellifera (или митотип М, по аналогии с
классификацией Ruttner et al., 1978, основанной на общем фенотипе
пчел); со значениями 0.51-0.94 - к гибридным пасекам с низким уровнем
гибридизации (митотип М-С); со значениями 0.00-0.50 - к гибридным
пасекам с высоким уровнем гибридизации (митотип С-М).
С учетом приведенной выше классификации, пять пасек изучаемых районов
(г. Бирска ул. Фрунзе и ул. Курбатово, д. Вязовка Бирского района,
пасека Салиева д. Камеево Мишкинского района и пасека д. Абызово
Караидельского района) мы отнесли к митотипу М-С; иглинскую выборку - к
митотипу С-М; остальные 42 пасеки - к митотипу М.
Таким образом, полученные нами высокие показатели частот встречаемости
комбинаций PQ, PQQ, PQQQ межгенного локуса COI-COII мтДНК (0.94-0.98),
позволяют утверждать о сохранении в исследуемых районах темной лесной
пчелы.
Таким образом, популяция северного ареала башкирской пчелы
A.m.mellifera характеризуется устойчивым соотношением внутри- и
межгрупповой компонент генного разнообразия, что отражает баланс
процессов интеграции и дифференциации видового генофонда. Данное
равновесное соотношение может сохраняться только при стабильных
значениях популяционных характеристик (F-коэффициенты и
гетерозиготность) на исторически сложившемся оптимальном уровне.
Анализ структуры популяции медоносной пчелы северного ареала Республики
Башкортостан по морфометрическим данным показал наличие 79% пасек с
содержанием семей А.m.mellifera и 21% - с присутствием гибридных
пчелиных семей.
Кластерный анализ по данным морфометрических исследований экстерьерных
признаков позволил отнести популяцию медоносной пчелы северного ареала
Республики Башкортостан (Бирский, Мишкинский, Караидельский районы) к
подвиду A.m.mellifera.
Высокие уровни показателей частот встречаемости комбинаций,
характеризующих пчел A.m.mellifera (PQ, PQQ, PQQQ), межгенного локуса
COI-COII мтДНК, в целом, по исследуемым районам (0.94-0.98) позволяют
говорить об их происхождении от темной лесной пчелы по материнской
линии.
Анализ полиморфизма микросателлитных локусов ар243, 4а110 и А8 ядерной
ДНК выявил генетическое родство между исследуемой популяцией северного
ареала башкирской пчелы и сравниваемыми бурзянской и татышлинской.
Анализ F-статистики и гетерозиготности в популяции северного ареала
башкирской пчелы позволили выявить отсутствие статистически значимой
генетической дифференциации (FST = 0.015) и инбридинга (FIS=0.122 и
FIT=0.135), а близкие значения наблюдаемых (0.435) и ожидаемых (0.485 и
0.493) значений гетерозиготности отражают равновесное состояние
популяции по Харди-Вайнбергу.
The aim of research was to study the structure of the honey bee
population of the northern area of the Republic of Bashkortostan in the
comparative population-genetic aspect.
According to the results of morphometric studies in Birsk, Mishkinskoye
and Karaidelsky District of the Republic of Bashkortostan 79% of the
apiaries were attributed to the dark forest bee subspecies
A.m.mellifera, 21% of apiaries - bees hybrid origin.
These morphometric studies fully confirmed the data obtained on the
basis of polymorphism of the intergenic locus COI-COII mtDNA and the
results of the analysis of variability of microsatellite loci ar243,
4a110 and A8 nuclear DNA.
The results of analysis of polymorphism of the intergenic locus
COI-COII mtDNA showed that the incidence of PQQ combination (Table 1.)
Bees studied areas ranged from 0.00 (2 apiary Birsk district - d
Vyazovka and e Starobazanovo 4 apiary Karaidelsky District - d
Taykash... , d. bike Yunusov and d. New Akbulyak) to 1.00 in the
absolute majority of the studied apiaries.
Comparing the values of the frequencies of occurrence of combinations
intergenic locus COI-COII mtDNA, studied and compared samples of bees
can be classified as follows: apiary with the values of PQ frequencies,
PQQ, PQQQ - 0.95-1.00 chistoprodnym attributed to the high level of
family content Ammellifera (or mitotype M ., by analogy with the
classification Ruttner et al, 1978, based on the overall phenotype
bees); with values of 0.51-0.94 - a hybrid apiaries low hybridization
(mitotype M-C); with values of 0.00-0.50 - a hybrid high-apiaries
hybridization (mitotype C-M).
In view of the above classification, five apiaries studied areas (Birsk
st. Frunze Str. Kurbatov, d. Vyazovka Birsk district apiary Salieva d.
Kameevo Mishkinsky area and apiary on. Abyzova Karaidelsky District),
we attributed to mitotype M-C ; Iglinskiy sample - to mitotype C-M; the
remaining 42 apiary - to mitotype M.
Thus, we have obtained high rates of occurrence of combinations of
frequencies PQ, PQQ, PQQQ intergenic locus COI-COII mtDNA (0.94-0.98)
suggest the preservation of the studied areas in the dark forest bees.
Thus, the population of the northern area of the Bashkir bee
A.m.mellifera characterized by a steady ratio of intra- and intergroup
components of genetic diversity, which reflects the balance of the
processes of integration and differentiation of the species gene pool.
This equilibrium relationship can only be maintained with stable values
of population characteristics (F-ratios and heterozygosity) on
historical optimum level.
Analysis of the structure of the honey bee population of the northern
area of the Republic of Bashkortostan on the morphometric data showed
the presence of 79% of apiaries containing A.m.mellifera families and
21% - with the presence of hybrid bee colonies.
Cluster analysis according to morphometric studies of exterior signs
allowed to carry a population of honeybee northern area of the Republic
of Bashkortostan (Birsk, Mishkinskoye, Karaidelsky District) to the
subspecies A.m.mellifera.
High levels of performance combinations of frequencies of occurrence,
characterizing the bees A.m.mellifera (PQ, PQQ, PQQQ), intergenic locus
COI-COII mtDNA, as a whole, according to the study area (0.94-0.98)
suggest their origin from the dark forest bees through the maternal
line.
Analysis of polymorphism of microsatellite loci ar243, 4a110 and A8
nuclear DNA revealed the genetic relationship between the studied
population of the northern area of the Bashkir bee compare Burzyan and
tatyshlinskoy. Analysis of the F-statistic and heterozygosity in the
northern area of the population of Bashkir bee revealed no
statistically significant genetic differentiation (FST = 0.015) and
inbreeding (FIS = 0.122 and FIT = 0.135), but similar values observed
(0.435) and expected (0.485 and 0.493) heterozygosity values reflect
the equilibrium state of a population of Hardy-Weinberg.
|
190. Николенко А.Г., Ильясов Р.А., Поскряков А.В. Глава 5.6. Ареал
бурзянской популяции темной лесной пчелы. В книге: Темная лесная пчела
Apis mellifera mellifera L. Республики Башкортостан / Ред. Р.А.
Ильясов, А.Г. Николенко, Н.М. Сайфуллина. Москва: Товарищество научных
изданий КМК, 2016. С. 236-243. ISBN 978-5-9908416-0-4. 320 с., 20 вкл.
(Nikolenko G. Alexei, Ilyasov A. Rustem, Poskryakov V. Alexandr.
Chapter 5.6. The area of distribution of Burzyan dark forest bees. In:
Ilyasov R.A., Nikolenko A.G., Saifullina N.M. Dark forest bee Apis
mellifera mellifera L. of the Republic of Bashkortostan. R.A. Ilyasov,
A.G. Nikolenko, N.M. Saifullina (eds.). Moscow: KMK Scientific Press,
2016. P. 236-243. ISBN 978-5-9908416-0-4. 320 p., 20 color inserts.)
Николенко А.Г., Ильясов Р.А., Поскряков А.В. Глава 5.6. Ареал
бурзянской популяции темной лесной пчелы. В книге: Темная лесная пчела
Apis mellifera mellifera L. Республики Башкортостан / Ред. Р.А.
Ильясов, А.Г. Николенко, Н.М. Сайфуллина. Москва: Товарищество научных
изданий КМК, 2016. С. 236-243. ISBN 978-5-9908416-0-4. 320 с., 20 вкл.
(Nikolenko G. Alexei, Ilyasov A. Rustem, Poskryakov V. Alexandr.
Chapter 5.6. The area of distribution of Burzyan dark forest bees. In:
Ilyasov R.A., Nikolenko A.G., Saifullina N.M. Dark forest bee Apis
mellifera mellifera L. of the Republic of Bashkortostan. R.A. Ilyasov,
A.G. Nikolenko, N.M. Saifullina (eds.). Moscow: KMK Scientific Press,
2016. P. 236-243. ISBN 978-5-9908416-0-4. 320 p., 20 color inserts.)
Пробы по 10 пчел из 495 семей (132 пасеки, 35 населенных пунктов, 22
борти) собраны в 2008-2010 гг. на территории Бурзянского и граничащих с
ним районов Республики Башкортостан. ДНК выделяли из мышц торакса
медоносной пчелы, фиксированной в 96% этаноле. Выделение проводили по
ранее описанному методу смесью гуанидинтиоцианат-фенол-хлороформ
(Chomzynski, Sacchi, 1987).
Географическое распределение вариантов локуса COI-COII мтДНК показано
на рис. 1. Наблюдается разделение генофонда медоносной пчелы на три
зоны. В центре присутствует только вариант PQQ, далее идут две области,
где появляется вариант PQQQ, а в двух выборках - PQ. По периметру
расположены выборки, включающие вариант Q.
Таким образом, географическое распределение вариантов локуса COI-COII
можно интерпретировать следующим образом. В выборках на всей территории
Бурзянского района вариант PQQ наблюдается с частотой 1.00, что,
возможно, соответствует центральной зоне ареала. В 1928-1929 гг.
экспедиция Г.А. Кожевникова отметила зону скопления обслуживаемых
бортей на несколько меньшей территории, вблизи деревень Галиакберово,
Гадельгареево, Мунасипово и Старосубхангулово (Кожевников, 1931). На
севере и юго-востоке наблюдаются две области, где помимо основного
варианта PQQ, присутствует вариант PQQQ (0.29-1.00), а в двух выборках
- вариант PQ (0.12 и 0.25). Обе области расположены вдоль транспортных
магистралей на пути к Бурзянскому району, что допускает возможность
завоза пчелиных семей извне. Эти области мы отнесли к периферии ареала
- краевым зонам. Располагающаяся по периметру карты область с
присутствием варианта Q свидетельствует о приближении к зоне
гибридизации подвидов.
Для анализа полиморфизма четырех микросателлитных локусов Ap243, 4A110,
A24 и Ap049 яДНК были использованы только выборки достаточного размера
(близкие к величине 20 пчелиных семей из одного или двух близко
расположенных населенных пунктов). Для сравнения взяты ранее полученные
данные по аналогичным выборкам из популяций Урала и Прикамья, а также
из популяций южных подвидов. Были рассчитаны величины Fst и построена
дендрограмма, отражающая генетические отношения субпопуляций (рис. 2).
Анализ полиморфизма мтДНК (рис. 1) свидетельствует об отсутствии
сколько-нибудь существенного завоза пчелиных семей на территорию
Бурзянского района. Этому способствуют как менталитет жителей, так и
меры администрации района. Маловероятен и значительный вывоз семей за
пределы района. Основным фактором необычного, узко протяженного
выравнивания генофонда по яДНК в обоих случаях может выступать лишь
интенсивный поток генов в виде трутневого фона. В качестве
дополнительного фактора сглаживания различий между центром и периферией
можно предположить трутневый фон свободно обитающих пчел: субпопуляции
кластеров расположены вдоль почти необитаемых лесов на хребтах Южного
Урала и водозаборах рек Нугуш, Ик и др.
Показано генетическое родство (разной степени) бортевых пчел с
пасечными пчелиными семьями в пределах ареала популяции. Генетические
процессы между ними требуют отдельного обсуждения. Генетическая
уникальность как бортевой, так и бурзянской популяции в целом
предполагалась многими авторами (Газизов, 2007), однако нам впервые
удалось показать на подробном экспериментальном материале генетическую
дифференциацию бурзянской популяции от большинства популяций Урала и
Поволжья.
Полученные результаты позволяют предполагать существование двойной
генетической границы ареала, которая должна быть присуща естественной
(длительно существующей) популяции медоносной пчелы в силу
биологических особенностей вида: радиус удаления от семьи матки и
трутней во время спаривания может достигать 12 км, дальность полета
пчелиного роя - 40 км и более. Впрочем, двойная генетическая граница
должна быть свойственна и популяциям многих видов с протяженным
сплошным ареалом.
Показано существование естественного интенсивного трутневого фона -
третьего (не по значимости) механизма, определяющего генетическую
стабильность естественной популяции, помимо изоляции и социального
фактора, известных ранее: активное ядро генофонда популяции формирует
краевые зоны, которые, в свою очередь, защищают это ядро. Таким
образом, помимо искусственных технологий - популяции закрытого типа и
принципа двойной замены маток - возможна стратегия естественного
сохранения генофонда медоносной пчелы, дающая более стабильный
результат.
The samples of 10 bees from 495 families (132 apiaries, 35 settlements,
22 boards) collected in 2008-2010. Burzyansky on site and neighboring
areas of the Republic of Bashkortostan. DNA was isolated from the
muscles of the thorax of the honey bee, fixed in 96% ethanol. Isolation
was performed according to the method previously described mixture of
guanidine thiocyanate-phenol-chloroform (Chomzynski, Sacchi, 1987).
The geographic distribution of variants of locus COI-COII mtDNA is
shown in Fig. 1. There is a separation of the honey bee gene pool into
three zones. In the center there is only the option of PQQ, two areas
where there is an option PQQQ go further, and in two samples - PQ.
Along the perimeter of the sample are located, including the option Q.
Thus, the geographic distribution of variants locus COI-COII can be
interpreted as follows. The samples on the entire territory of the
district Burzyansky PQQ variant occurs with a frequency of 1.00, which
may correspond to the area of the central zone. In 1928-1929 gg.
Expedition GA Kozhevnikova said accumulation zone served aboard several
smaller areas near the villages Galiakberova, Gadelgareevo, Munasipovo
and Starosubkhangulovo (Kozhevnikov, 1931). In the north and south-east
there are two areas, where in addition to the basic variant of PQQ,
there is an option PQQQ (0.29-1.00), and in two samples - version of PQ
(0.12 and 0.25). Both areas are located along the highways on the way
to Burzyansky District, which allows for the possibility of importation
of bee colonies outside. These areas we carried to the periphery of the
area - the boundary zones. Located on the perimeter of the area of the
map with the presence of variant Q indicates the approaching zone
subspecies hybridization.
For the analysis of polymorphisms of four microsatellite loci Ap243,
4A110, A24 and Ap049 only nuclear DNA of sufficient size samples were
used (close to the value of 20 bee colonies of one or two nearby
settlements). For comparison, the data previously taken on similar
samples from populations of the Urals and the Kama region, as well as
the populations of the southern subspecies. Fst values were calculated
and constructed dendrogram showing the genetic relationships
subpopulations (Fig. 2).
Analysis of mtDNA polymorphism (Fig. 1) indicates the absence of any
significant importation of bee colonies in the territory Burzyansky
area. It is promoted as the mentality of the inhabitants, and the
measures of the district administration. Is unlikely and substantial
removal of families outside the area. The main factor of the ordinary,
narrow elongated alignment of the gene pool by nuclear DNA in both
cases, can act only intensive gene flow in the form of a background
drone. An additional factor, smoothing the differences between the
center and the periphery can assume male bee background freely living
bees: subpopulation clusters located along the almost uninhabited
forests on the ridges of the Southern Urals and intakes Nugush rivers
Ik and others.
Displaying genetic relatedness (of varying degrees) with wild-hive bee
bee bee families within the range of the population. Genetic processes
between them require a separate discussion. The genetic uniqueness as a
wild-hive and Burzyan the general population assumed by many authors
(Gazizov, 2007), but we were able to show for the first time on a
detailed experimental material genetic differentiation Burzyan
populations of most populations of the Urals and the Volga region.
These results suggest the existence of a double genetic border of the
area that should be inherent in the natural (continuous current)
population of honey bees due to the biological characteristics of
species: the radius of the removal of the uterus and drones family
during mating can reach 12 km, range beehive - 40 km and more. However,
the double border should be a genetic characteristic of many
populations and species with extended continuous habitat.
The existence of natural background of intense drone - the third (not
least) the mechanism that determines the genetic stability of the
natural populations, in addition to isolation and social factor,
previously known: the active nucleus of the gene pool of the population
forms the boundary zone, which, in turn, protect this core. Thus, in
addition to man-made technology - gated population and the principle of
double replacement ewes - Possible strategies of natural preservation
of the gene pool of the honey bee, which gives a more stable result.
|
189. Фархутдинов Р.Г., Ильясов Р.А., Юмагужин Ф.Г., Уразбахтина Н.А.,
Туктарова Ю.В., Шафикова В.М., Абдуллин М.Ф. Глава 4.7. Применение
фитосбора для лечения аскосфероза темной лесной пчелы башкирской
популяции. В книге: Темная лесная пчела Apis mellifera mellifera L.
Республики Башкортостан / Ред. Р.А. Ильясов, А.Г. Николенко, Н.М.
Сайфуллина. Москва: Товарищество научных изданий КМК, 2016. С. 162-172.
ISBN 978-5-9908416-0-4. 320 с., 20 вкл. (Farkhutdinov G. Rashit,
Ilyasov A. Rustem, Yumaguzhin G. Fitrat, Urazbakhtina A. Nuriya,
Tuktarova V. Yuliya, Shafikova M. Venera, Abdullin F. Marat. Chapter
4.7. The use of drugs on the basis of phytoextracts (extracts of drug
plants) against ascospaerosis (Ascospaera apis) in the native
population of dark forest bees. In: Ilyasov R.A., Nikolenko A.G.,
Saifullina N.M. Dark forest bee Apis mellifera mellifera L. of the
Republic of Bashkortostan. R.A. Ilyasov, A.G. Nikolenko, N.M.
Saifullina (eds.). Moscow: KMK Scientific Press, 2016. P. 162-172. ISBN
978-5-9908416-0-4. 320 p., 20 color inserts.)
Фархутдинов Р.Г., Ильясов Р.А., Юмагужин Ф.Г., Уразбахтина Н.А.,
Туктарова Ю.В., Шафикова В.М., Абдуллин М.Ф. Глава 4.7. Применение
фитосбора для лечения аскосфероза темной лесной пчелы башкирской
популяции. В книге: Темная лесная пчела Apis mellifera mellifera L.
Республики Башкортостан / Ред. Р.А. Ильясов, А.Г. Николенко, Н.М.
Сайфуллина. Москва: Товарищество научных изданий КМК, 2016. С. 162-172.
ISBN 978-5-9908416-0-4. 320 с., 20 вкл. (Farkhutdinov G. Rashit,
Ilyasov A. Rustem, Yumaguzhin G. Fitrat, Urazbakhtina A. Nuriya,
Tuktarova V. Yuliya, Shafikova M. Venera, Abdullin F. Marat. Chapter
4.7. The use of drugs on the basis of phytoextracts (extracts of drug
plants) against ascospaerosis (Ascospaera apis) in the native
population of dark forest bees. In: Ilyasov R.A., Nikolenko A.G.,
Saifullina N.M. Dark forest bee Apis mellifera mellifera L. of the
Republic of Bashkortostan. R.A. Ilyasov, A.G. Nikolenko, N.M.
Saifullina (eds.). Moscow: KMK Scientific Press, 2016. P. 162-172. ISBN
978-5-9908416-0-4. 320 p., 20 color inserts.)
Эффективность лечебных обработок пчелиной семьи определяли сравнением
количества пораженных аскосферозом личинок. Подсчет количества
инфицированных личинок проводился каждую декаду в течение 2-х месяцев.
Влияние подкормок на продуктивные показатели оценивали по методикам,
принятым в зоотехнии (Лебедев и др., 2007; Туктаров, Галиуллин, 2011).
Нами был проведен сравнительный анализ фунгицидных свойств спиртовых и
водных экстрактов растительного сбора, для коррекции рецептуры сбора.
Было установлено, что спиртовые экстракты растительного сбора более
активны по отношению к A. apis по сравнению с водными, что, видимо,
связано с определенным соотношением веществ спиртового экстракта (табл.
2).
Как видно из табл. 2, уровень фунгицидного действия спиртового
экстракта растительного сбора был близок к величине воздействия
нистатина на грибной газон A. apis. Примерно на 20% площадь газона,
росшего на агаре, содержащем спиртовой экстракт, была больше, чем на
среде с нистатином.
В варианте с водным экстрактом площадь была больше на 215% по сравнению
с нистатином и на 180% по сравнению со спиртовым экстрактом.
Возвращаясь к табл. 1, мы можем сделать предположение, что преобладание
определенных групп веществ в спиртовом растворе обеспечивает более
высокие фунгицидные свойства, что необходимо будет учитывать при
стандартизации готового препарата по действующим веществам при введении
его в производство.
Определение антигрибкового действия экстрактов отдельных растений,
входящих в состав сбора, показало, что активность была различной. В
определенной степени это связано с тем, что помимо растений
фунгицидного действия, в его состав были включены растения, обладающие
стимулирующими свойствами. Наиболее эффективными в фунгицидном действии
по отношению к A. api - оказались экстракты травы вероники, чистотела,
листа березы, хвои пихты и чеснока. Однако суммарное фунгицидное
действие фитосбора было выше, чем отдельных его компонентов, т.е. можно
судить об их синергетическом действии.
Влияния экстракта растительного сбора на активность ферментов,
содержание запасных и минеральных веществ в теле пчел.
Благополучие зимовки пчел зависит от многих факторов: зимостойкости
пчел, формирования гнезда, количества и качества корма, условий
зимовки, подготовки пчел к зимовке, ухода за пчелами, состояния их
здоровья и др. (Жеребкин, 1979). Применение в лечении пчелиных семей
препаратов, состоящих из природных компонентов, помогает избегать
многих побочных эффектов, так как их механизмы основаны на активации
естественных защитных реакций организма (Хамадиева и др., 2012).
Нами было установлено положительное влияние подкормки сиропом с
экстрактом фитопрепаратов на увеличение активности ферментов каталазы и
пероксидазы, как показателей зимостойкости пчел. Так, в ноябре месяце
(в пчелиных семьях обычно в это время сформирован клуб) нами были
определены активности ферментов каталазы и пероксидазы в кишечнике
пчел. Результаты показали, что активность фермента каталазы была выше в
1 группе (экстракт родиолы розовой) на 88%, а во 2 группе
(экстракт фитосбора) - на 58% по сравнению с 3 контрольной группой
(табл. 3). Активность фермента пероксидазы была выше в 1 группе на 16%,
а во 2 группе - на 9% по сравнению с 3 контрольной группой. Это дает
основание, опираясь на данные литературы (Хамадиева и др., 2012;
Салтыкова и др., 2007; Брандорф, Ивойлова, 2011), предполагать, что
осенняя подкормка пчелиных семей сиропом с экстрактом растительного
сбора приводит к лучшей подготовке пищеварительной системы пчел к
длительному безоблетному периоду во время зимовки.
Определение количества расплода показало, что матки больше всего
откладывали яица во 2 группе: на 26% и на 13% по сравнению с контролем
в 1 группе. Определение силы семьи показало, что применение препаратов
(нистатина и сбора) привело к увеличению числа пчел примерно в среднем
на 13% и 25% соответственно.
Таким образом, было установлено, что растительный сбор в условиях in
vitro обладал фунгицидным действием. При подкормке пчел сиропом с
экстрактом растительного сбора, обладающего фунгицидным и стимулирующим
действием, происходило оздоровление расплода пчел, улучшение развития
семьи, повышение зимостойкости и продуктивности.
We carried out a comparative analysis of the fungicidal properties of
alcohol and aqueous extracts of plant collection, for the collection of
recipe correction. It was found that alcoholic extracts of plant
collecting more active against A. apis compared with water that is
apparently associated with a certain ratio of alcoholic extract
substances (Table. 2).
As can be seen from Table. 2, the level of fungicidal activity of plant
collecting alcoholic extract was close to the magnitude of the impact
of nystatin on fungal lawn A. apis. Approximately 20% of the lawn area
that grew on agar containing an alcoholic extract, is greater than the
medium with nystatin.
In an area with the aqueous extract was higher by 215% compared to
nystatin and 180% compared with the alcoholic extract. Returning to the
table. 1, we can make the assumption that the prevalence of certain
groups of substances in alcohol solution provides higher fungicidal
properties that need to be taken into account in the standardization of
the finished product for active substances when introduced into
production.
Determination of the antifungal activities of certain plant extracts
that make up the collection, showed that the activity was different. To
some extent, this is due to the fact that the fungicidal activity than
plants in its composition included plants with stimulating properties.
The most effective fungicidal action in relation to A. api - were
extracts of herbs veronica, celandine, birch leaves, fir needles and
garlic. However, the total fitosbora fungicidal effect was greater than
its individual components, i.e. You can judge their synergistic effect.
Effects of plant extract on the enzyme activity of collecting, content
replacement and minerals in the body of the bees.
Welfare wintering bees depends on many factors: hardiness of bees,
forming nest, the quantity and quality of food, winter conditions,
training bees to winter in, the care of bees, their health status, etc.
(Zherebkin, 1979).. The use in the treatment of bee colonies
preparations consisting of natural components, avoids many of the side
effects, since their mechanisms are based on the activation of natural
defense reactions (Hamadieva et al., 2012).
We have found positive effects feeding syrup with an extract of herbal
remedies to increase the activity of enzymes catalase and peroxidase as
indicators hardiness of bees. So, in November (in bee colonies is
usually at this time formed the club), we define the activity of
catalase and peroxidase enzymes in the gut of bees. The results showed
that the enzyme catalase activity was higher in group 1 (Rhodiola rosea
extract) was 88%, while in group 2 (Extract fitosbora) - by 58%
compared to the control group 3 (Table 3.). The enzyme activity of
peroxidase was higher in Group 1 at 16%, and in group 2 - 9% compared
to the control group 3. This gives grounds for relying on literature
data (Hamadieva et al, 2012;. Saltykov, and others, 2007;. Brandorf,
Ivoilova 2011), suggests that the autumn feeding bee colonies syrup
with an extract of the plant collection leads to a better digestive
system preparation bees to bezobletnomu prolonged period during the
winter.
Quantification brood showed that most delayed uterine eggs in Group 2:
26% and 13% compared to the control group in 1. Determination force
family revealed that the use of drugs (and collection nystatin) has
increased the number of bees on average approximately 13% and 25%
respectively.
Thus, it was found that the plant charge under in vitro fungicidal
activity possessed. When feeding bees syrup with an extract of the
plant collection, having fungicidal and stimulating effect, there was
improvement of the brood of bees, improvement of family development,
increase productivity and winter hardiness.
|
188. Ильясов Р.А., Косарев М.Н., Юмагужин Ф.Г. Глава 1.5. Современная
популяция бурзянской бортевой темной лесной пчелы на Южном Урале. В
книге: Темная лесная пчела Apis mellifera mellifera L. Республики
Башкортостан / Ред. Р.А. Ильясов, А.Г. Николенко, Н.М. Сайфуллина.
Москва: Товарищество научных изданий КМК, 2016. С. 26-29. ISBN
978-5-9908416-0-4. 320 с., 20 вкл. (Ilyasov A. Rustem, Kosarev N.
Michail, Yumaguzhin G. Fitrat. Chapter 1.5. The modern population of
Burzyan wild-hive dark forest bees in the southern Urals. In: Ilyasov
R.A., Nikolenko A.G., Saifullina N.M. Dark forest bee Apis mellifera
mellifera L. of the Republic of Bashkortostan. R.A. Ilyasov, A.G.
Nikolenko, N.M. Saifullina (eds.). Moscow: KMK Scientific Press, 2016.
P. 26-29. ISBN 978-5-9908416-0-4. 320 p., 20 color inserts.)
Ильясов Р.А., Косарев М.Н., Юмагужин Ф.Г. Глава 1.5. Современная
популяция бурзянской бортевой темной лесной пчелы на Южном Урале. В
книге: Темная лесная пчела Apis mellifera mellifera L. Республики
Башкортостан / Ред. Р.А. Ильясов, А.Г. Николенко, Н.М. Сайфуллина.
Москва: Товарищество научных изданий КМК, 2016. С. 26-29. ISBN
978-5-9908416-0-4. 320 с., 20 вкл. (Ilyasov A. Rustem, Kosarev N.
Michail, Yumaguzhin G. Fitrat. Chapter 1.5. The modern population of
Burzyan wild-hive dark forest bees in the southern Urals. In: Ilyasov
R.A., Nikolenko A.G., Saifullina N.M. Dark forest bee Apis mellifera
mellifera L. of the Republic of Bashkortostan. R.A. Ilyasov, A.G.
Nikolenko, N.M. Saifullina (eds.). Moscow: KMK Scientific Press, 2016.
P. 26-29. ISBN 978-5-9908416-0-4. 320 p., 20 color inserts.)
Темная лесная пчела Apis mellifera mellifera - уникальный подвид
медоносной пчелы Apis mellifera, эволюционно приспособленный к обитанию
в условиях континентального климата Северной Европы с длительными
холодными зимами. На современном этапе развития пчеловодства пчелы
этого подвида сохранились лишь в немногочисленных изолятах в виде
небольших островков в Европе. Самые многочисленные массивы темной
лесной пчелы в Европе имеются в России: около 300 000 слабо затронутых
стихийной гибридизацией семей в Республике Башкортостан на Южном Урале,
около 200 000 семей в Пермском крае на Среднем Урале (Шураков и др.,
1999; Ильясов и др., 2006) и около 250 000 семей в Республике Татарстан
в Поволжье (Кривцов, Гранкин, 2004). Есть сведения о сохранении
значительных массивов темной лесной пчелы в Республике Удмуртия,
Кировской области и Алтайском крае (Ильясов и др., 2007a; Кривцов,
2011; Брандорф и др., 2012). Примерно 99% семей темной лесной пчелы на
Южном Урале содержится в рамочных ульях и около 1% обитает в лесах в
естественных и искусственных (бортях и колодах) дуплах в стволах
деревьев, преимущественно в Бурзянском районе Республики Башкортостан
(рис. 1).
В настоящее время темные лесные пчелы, обитающие в бортях, колодах и
естественных дуплах, сохранились на Южном Урале в государственном
заповеднике «Шульган-Таш» площадью 22 000 га (создан в 1958
г.), региональном природном заказнике «Алтын Солок»
площадью 90 000 га (учрежден в 1997 г.) и национальном парке
«Башкирия» площадью 82 000 га (образован в 1986 г.)
(Косарев, 2008). В конце 2014 г. в период очередной популяционной
депрессии на территории заповедника, заказника и национального парка
имелось более 1200 деревьев с бортями и колодами, из которых было
заселено около 300 искусственных дупел. Примерно 4 000 пчелиных семей
бурзянской бортевой темной лесной пчелы в этой зоне содержится на
пасеках с рамочными ульями, а в естественных дуплах по данным
экстраполяции учетных материалов обитает 200-400 «дичков».
В 2012 г. перечисленные особо охраняемые природные территории вместе с
рядом иных получили статус комплексного биосферного резервата ЮНЕСКО
«Башкирский Урал» общей площадью 346 000 га, а региональный
заказник «Алтын Солок» стал реально охраняться Минэкологией
Республики Башкортостан. В настоящее время с целью сохранения
бурзянской бортевой темной лесной пчелы и в рамках развития резервата
планируется расширение территории заповедника «Шульган-Таш»
в северо-западном направлении за счет неосвоенной территории в
междуречье рек Нугуш и Урюк (Косарев и др., 2002; Юмагужин, 2009).
Сотрудники заповедника «Шульган-Таш», заказника
«Алтын Солок» и национального парка «Башкирия»
совместно с местными пчеловодами постоянно проводят мероприятия по
оптимизации численности и селекционную работу по повышению иммунитета,
зимостойкости и продуктивности семей бурзянской бортевой темной лесной
пчелы, распространению опыта бортевого пчеловодства. Такая политика
государственных природоохранных учреждений позволяет сохранять
уникальную популяцию бортевых пчел - изолят A.m.mellifera в Европе в
условиях новых угроз стихийной гибридизации и разрушения мест обитания
(Юмагужин, 2009; Косарев и др., 2011).
The dark forest bee Apis mellifera mellifera - a unique subspecies of
the honeybee Apis mellifera, evolutionarily adapted to life in
conditions of Northern Europe continental climate with long cold
winters. At the present stage of development of bee bee this subspecies
survived only a few isolates in the form of small islands in Europe.
The largest tracts of dark forest bees in Europe are in Russia. About
300,000 slightly affected by natural families hybridization in the
Republic of Bashkortostan in the southern Urals, nearly 200 000
families in the Perm region in the Middle Urals (Shurakov et al, 1999;
Ilyasov et al. 2006) and about 250 000 families in the Republic of
Tatarstan in the Volga region (Krivtsov, Grankin, 2004). There is
information on the conservation of significant arrays dark forest bees
in the Republic of Udmurtia, Kirov Region and the Altai Territory
(Ilyasov et al, 2007a;. Krivtsov 2011; Brandorf et al, 2012.).
Approximately 99% of households dark forest bees in the Southern Urals
is contained in frame beehives and about 1% lives in the forests of
natural and artificial (board and decks) hollows in tree trunks, mostly
in Burzyansky District Republic of Bashkortostan (Fig. 1).
At present, the dark forest bees that live in the board, decks and
natural hollows have been preserved in the southern Urals in the State
Reserve "Shulgan-Tash" area of 22 000 ha (established in 1958), the
regional nature reserve "Altyn Solok" an area of 90 000 ha (established
in 1997) and the national park "Bashkiria" area of 82 000 ha (founded
in 1986) (Kosarev, 2008). At the end of 2014, another period of
depression population in the reserve, the reserve and the national park
had more than 1,200 trees to the sides and decks of which was inhabited
around 300 artificial hollows. Approximately 4000 wild-hive bee
colonies Burzyan dark forest bees in this area contained in the
apiaries with framed hives and 200-400 "wildings" dwells in natural
cavities according to the extrapolation of accounting materials.
In 2012, the listed protected areas, along with several other granted
the status of UNESCO biosphere reserve complex "Bashkir Ural" with
total area of 346 000 hectares, and the regional reserve "Altyn Solok"
was actually protected by the Ministry of Environment of the Republic
of Bashkortostan. Currently, in order to preserve Burzyan wild-hive
dark forest bees and in the development of the reserve is planned to
expand the territory of "Shulgan-Tash" reserve in the north-west by
undeveloped area between the rivers Nugush and Uruk (Kosarev et al.,
2002; Yumaguzhin, 2009). Reserve staff "Shulgan-Tash" reserve "Altyn
Solok" and national park "Bashkiria", together with local beekeepers is
constantly taking measures to optimize the number and selection work to
improve immunity, hardiness and productivity of families Burzyan
wild-hive dark forest bees, extension wild-hive beekeeping . Such a
policy of state environmental agencies allows you to save a unique
population of wild-hive bee - isolate A.m.mellifera in Europe in the
face of new threats spontaneous hybridization and habitat destruction
(Yumaguzhin, 2009; Kosarev et al, 2011.).
|
187. Ильясов Р.А., Николенко А.Г., Сайфуллина Н.М. Темная лесная пчела
Apis mellifera mellifera L. Республики Башкортостан. Под ред. Р.А.
Ильясова, А.Г. Николенко, Н.М. Сайфуллиной. Москва: Товарищество
научных изданий КМК, 2016. 320 с., 20 вкл. ISBN 978-5-9908416-0-4.
(Ilyasov R.A., Nikolenko A.G., Saifullina N.M. Dark forest bee Apis
mellifera mellifera L. of the Republic of Bashkortostan. R.A. Ilyasov,
A.G. Nikolenko, N.M. Saifullina (eds.). Moscow: KMK Scientific Press,
2016. 320 p., 20 color inserts. ISBN 978-5-9908416-0-4.)
Ильясов Р.А., Николенко А.Г., Сайфуллина Н.М. Темная лесная пчела Apis
mellifera mellifera L. Республики Башкортостан. Под ред. Р.А. Ильясова,
А.Г. Николенко, Н.М. Сайфуллиной. Москва: Товарищество научных изданий
КМК, 2016. 320 с., 20 вкл. ISBN 978-5-9908416-0-4. (Ilyasov R.A.,
Nikolenko A.G., Saifullina N.M. Dark forest bee Apis mellifera
mellifera L. of the Republic of Bashkortostan. R.A. Ilyasov, A.G.
Nikolenko, N.M. Saifullina (eds.). Moscow: KMK Scientific Press, 2016.
320 p., 20 color inserts. ISBN 978-5-9908416-0-4.)
Коллективная научная монография представляет собой собрание
теоретических и экспериментальных работ сотрудников научных центров
Республики Башкортостан, занимающихся решением задач по сохранению
генофонда башкирской популяции темной лесной пчелы. Книга рекомендована
для преподавателей, студентов, научных сотрудников, пчеловодов в
качестве учебно-методического пособия, научно-практического руководства
и справочника в области пчеловодства.
The collective monograph is a collection of theoretical and
experimental studies of the scientists of different scientific centers
of the Republic of Bashkortostan involved in problems of the gene pool
preservation of the dark forest bee of Bashkir population. This book
recommended for teachers, students, researchers, beekeepers as
scientific and practical manual, guide and reference book in the field
of the beekeeping.
|
186. Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Темная
лесная пчела Apis mellifera mellifera Урала и Поволжья. Материалы
международной научно-практической конференции «Современные
проблемы пчеловодства и пути их решения». Москва: ФГБОУ ВО
«РГАУ-МСХА имени К.А. Тимирязева». 10-12 марта 2016. С.
95-103.
Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Темная
лесная пчела Apis mellifera mellifera Урала и Поволжья. Материалы
международной научно-практической конференции «Современные
проблемы пчеловодства и пути их решения». Москва: ФГБОУ ВО
«РГАУ-МСХА имени К.А. Тимирязева». 10-12 марта 2016. С.
95-103.
Ilyasov R.A., Poskryakov A.V., Petukhov A.V., Nikolenko A.G. Dark
european bee Apis mellifera mellifera of the Ural and Volga region.
Proceedings of the international scientific-practical conference "
Modern problems of beekeeping and their solutions». Moscow: FGBOU
VO “RGAU-MSCHA named of K.A. Timiryazev”10-12 march 2016.
P. 95-103.
Нами были изучены локальные популяции темной лесной пчелы A. m.
mellifera Урала и Поволжья в сравнении с локальными популяциями пчел
южных подвидов A. m. caucasica и A. m. carpatica Кавказа и Карпат.
Генетический анализ проводился на основе полиморфизма 9
микросателлитных локусов ядерной ДНК и локуса COI-COII мтДНК. На
территории Урала и Поволжья нами были выделены 5 сохранившихся
популяций (резерватов) темной лесной пчелы A. m. mellifera: бурзянская,
татышлинская, южно-прикамская, вишерская и камбарская. Эти пять
популяций составляют основу современного генофонда темной лесной пчелы
A. m. mellifera Урала и Поволжья. Основной массив сохранившегося
аборигенного генофонда A. m. mellifera (ядро генофонда популяции A. m.
mellifera) располагается на территории всего Пермского края и Севера
Республики Башкортостан. Для популяции пчел A. m. mellifera Урала и
Поволжья были рассчитаны генетические стандарты, которые будут полезны
для последующих популяционных исследований медоносной пчелы.
Based on the spatial distribution of local populations in the Urals and
the Volga region identified five surviving populations ( reserves )
dark forest bees A. m. mellifera: Burzyan, tatyshlinskaya, South
Prikamskaya, Visherskaya and Kambarka. This population is currently
characterized by a sufficient number of stable and balanced genetic and
genotypic structure and a small deviation in the distribution of
genotype frequencies from the equilibrium distribution of Hardy–
Weinberg. To successfully save us five isolated populations of a dark
forest bees in the Urals and the Volga region it is necessary to
continuously monitor and control their gene pool in accordance with the
principles of population genetics.
|
185. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Селекция на основе
генетических характеристик. Пчеловодство. 2016. № 8. С. 12-15.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Селекция на основе генетических характеристик. Пчеловодство. 2016. № 8. С. 12-15.
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. A selection of the dark
forest bee A. m. mellifera colonies based on the genetic
characteristics (translated). Russian Journal of Beekeeping
“Pchelovodstvo”. 2016. No. 8. P. 12-15.
Проведен молекулярно-генетический анализ популяций и семей темной
лесной пчелы A. m. mellifera Урала и Поволжья в сравнении с популяциями
пчел южных подвидов A. m. caucasica и A. m. carpatica Кавказа и Карпат
на основе полиморфизма 9 микросателлитных локусов яДHK. В статье
рассчитаны генетические характеристики для популяции (Ho=0.24, Hs=0.23,
Ht=0.28, Fis=0.06, Fit=0.14, Fst=0.17) и семьи (Ho=0.20, Hs=0.16,
Ht=0.15, Fis=0.23, Fit=0.35, Fst=0.11) темной лесной пчелы A. m.
mellifera и предложена методика селекции семей темной лесной пчелы с
интрогрессией “южных” генов не более 5%, и генетическими
показателями, характерными для чистопородных семей A. m. mellifera (Ho
≤ 0.30, Hs ≤ 0.30, Ht ≤ 0.30, Fis ≤ │0.45│, Fit ≤
│0.55│, Fst ≥ │0.11│).
A molecular genetic analysis of populations and colonies of the dark
forest bee A. m. mellifera from the Urals and the Volga region in
comparison with populations of the bees of southern subspecies A. m.
caucasica and A. m. carpatica from the Caucasus and the Carpathians
have carried out based on the polymorphism 9 microsatellite loci of the
nuclear DNA. The genetic characteristics of the population (Ho=0.24,
Hs=0.23, Ht=0.28, Fis=0.06, Fit=0.14, Fst=0.17) and the colony
(Ho=0.20, Hs=0.16, Ht=0.15, Fis=0.23, Fit=0.35, Fst=0.11) of the dark
forest bee A. m. mellifera were calculated and the method of selection
of the dark forest bee colonies with introgression of "southern" less
than 5% and genetic characteristic of thoroughbred colonies A. m.
mellifera (Ho ≤ 0.30, Hs ≤ 0.30, Ht ≤ 0.30, Fis ≤ │0.45│,
Fit ≤ │0.55│, Fst ≥ │0.11│) was proposed in this article. |
184. Ilyasov R.A., Poskryakov A.V., Petukhov A.V., Nikolenko A.G.
Molecular genetic analysis of five extant reserves of black honeybee
Apis melifera melifera in the Urals and the Volga Region. Russian
Journal of Genetics, 2016, V. 52, No. 8, P. 828–839. DOI:
10.1134/S1022795416060053.
Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г.
Молекулярно-генетический анализ пяти сохранившихся резерватов темной
лесной пчелы Apis mellifera mellifera Урала и Поволжья. Генетика. 2016.
Т. 52. № 8. С. 931–942. (IF 0.446). DOI:
10.7868/S0016675816060059.
Ilyasov R.A., Poskryakov A.V., Petukhov A.V., Nikolenko A.G. Molecular
genetic analysis of five extant reserves of black honeybee Apis
melifera melifera in the Urals and the Volga Region. Russian Journal of
Genetics, 2016, V. 52, No. 8, P. 828–839. DOI:
10.1134/S1022795416060053.
Изучены локальные популяции темной лесной пчелы Apis mellifera
mellifera Урала и Поволжья в сравнении с локальными популяциями пчел
южных подвидов A. m. caucasica и A. m. carpatica Кавказа и Карпат.
Генетический анализ проводился на основе полиморфизма девяти
микросателлитных локусов ядерной ДНК и локуса COI-COII мтДНК. На
территории Урала и Поволжья нами были выделены пять сохранившихся
популяций (резерватов) темной лесной пчелы A. m. mellifera: бурзянская,
татышлинская, южно-прикамская, вишерская и камбарская. Эти пять
популяций составляют основу современного генофонда темной лесной пчелы
A. m. mellifera Урала и Поволжья. Основной массив сохранившегося
аборигенного генофонда A. m. mellifera (ядро генофонда популяции A. m.
mellifera) располагается на территории всего Пермского края и Севера
Республики Башкортостан. Для популяции пчел A. m. mellifera Урала и
Поволжья были рассчитаны генетические стандарты, которые бу дут полезны
для последующих популяционных исследований медоносной пчелы.
Local populations of the black honeybee Apis mellifera mellifera from
the Urals and the Volga region were examined in comparison with local
populations of southern honeybee subspecies A. m. caucasica and A. m.
carpatica from the Caucasus and the Carpathians. Genetic analysis was
performed on the basis of the polymorphism of nine microsatellite loci
of nuclear DNA and the mtDNA COI–COII locus. On the territory of
the Urals and the Volga region, five extant populations (reserves) of
the black honeybee A. m. mellifera were identified, including the
Burzyanskaya, Tatyshlinskaya, Yuzhno-Prikamskaya, Visherskaya, and
Kambarskaya populations. These five populations are the basis of the
modern gene pool of the black honeybee A. m. mellifera from the Urals
and the Volga region. The greatest proportion of the remaining
indigenous gene pool of A. m. mellifera (the core of the gene pool of
the population of A. m. mellifera) is distributed over the entire
territory of Perm krai and the north of the Republic of Bashkortostan.
For the population of A. m. mellifera from the Urals and the Volga
region, the genetic standards were calculated, which will be useful for
future population studies of honeybees.
|
183. Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г.
Молекулярно-генетический анализ пяти сохранившихся резерватов темной
лесной пчелы Apis mellifera mellifera Урала и Поволжья. Генетика. 2016.
Т. 52. № 8. С. 931–942. (IF 0.446). DOI:
10.7868/S0016675816060059.
Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г.
Молекулярно-генетический анализ пяти сохранившихся резерватов темной
лесной пчелы Apis mellifera mellifera Урала и Поволжья. Генетика. 2016.
Т. 52. № 8. С. 931–942. (IF 0.446). DOI:
10.7868/S0016675816060059.
Ilyasov R.A., Poskryakov A.V., Petukhov A.V., Nikolenko A.G. Molecular
genetic analysis of five extant reserves of black honeybee Apis
melifera melifera in the Urals and the Volga Region. Russian Journal of
Genetics, 2016, V. 52, No. 8, P. 828–839. DOI:
10.1134/S1022795416060053.
Изучены локальные популяции темной лесной пчелы Apis mellifera
mellifera Урала и Поволжья в сравнении с локальными популяциями пчел
южных подвидов A. m. caucasica и A. m. carpatica Кавказа и Карпат.
Генетический анализ проводился на основе полиморфизма девяти
микросателлитных локусов ядерной ДНК и локуса COI-COII мтДНК. На
территории Урала и Поволжья нами были выделены пять сохранившихся
популяций (резерватов) темной лесной пчелы A. m. mellifera: бурзянская,
татышлинская, южно-прикамская, вишерская и камбарская. Эти пять
популяций составляют основу современного генофонда темной лесной пчелы
A. m. mellifera Урала и Поволжья. Основной массив сохранившегося
аборигенного генофонда A. m. mellifera (ядро генофонда популяции A. m.
mellifera) располагается на территории всего Пермского края и Севера
Республики Башкортостан. Для популяции пчел A. m. mellifera Урала и
Поволжья были рассчитаны генетические стандарты, которые бу дут полезны
для последующих популяционных исследований медоносной пчелы.
Local populations of the black honeybee Apis mellifera mellifera from
the Urals and the Volga region were examined in comparison with local
populations of southern honeybee subspecies A. m. caucasica and A. m.
carpatica from the Caucasus and the Carpathians. Genetic analysis was
performed on the basis of the polymorphism of nine microsatellite loci
of nuclear DNA and the mtDNA COI–COII locus. On the territory of
the Urals and the Volga region, five extant populations (reserves) of
the black honeybee A. m. mellifera were identified, including the
Burzyanskaya, Tatyshlinskaya, Yuzhno-Prikamskaya, Visherskaya, and
Kambarskaya populations. These five populations are the basis of the
modern gene pool of the black honeybee A. m. mellifera from the Urals
and the Volga region. The greatest proportion of the remaining
indigenous gene pool of A. m. mellifera (the core of the gene pool of
the population of A. m. mellifera) is distributed over the entire
territory of Perm krai and the north of the Republic of Bashkortostan.
For the population of A. m. mellifera from the Urals and the Volga
region, the genetic standards were calculated, which will be useful for
future population studies of honeybees.
|
182. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Организация генома
медоносной пчелы Apis mellifera. Биомика. 2016. Т. 8. № 2. С. 97-99.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Организация генома
медоносной пчелы Apis mellifera. Биомика. 2016. Т. 8. № 2. С. 97-99.
(Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. The honey bee Apis
mellifera genome organisation (translated). Biomics. 2016. V. 8 (2). P.
97-99.)В статье представлен анализ ядерного и митохондриального геномов
медоносной пчелы Apis mellifera в сравнении с геномом плодовой мушки
Drosophila melanogaster. Ядерный геном медоносной пчелы размером около
245 млн. п. н. распределен между 16 хромосомами и содержит около 10
тыс. генов. Митохондриальный геном медоносной пчелы размером около 16
тыс. п. н. расположен в митохондриях и содержит 35 генов. Несмотря на
полное секвенирование ядерного и митохондриального геномов медоносной
пчелы, функции многих генов и локусов еще до конца не раскрыты.
The analysis of the nuclear and the mitochondrial genomes of the honey
bee Apis mellifera in comparison with genomes of fruit fly Drosophila
melanogaster were showed in this article. The nuclear genome of the
honey bee has about 245 millions b. p. which distributed in 16
chromosomes and contains about 10 thousands genes. The mitochondrial
genome of the honey bee has about 16 thousands b. p. which located in
mitochondrions and contains 35 genes. Despite the full sequencing of
the nuclear and the mitochondrial genomes of the honey bee Apis
mellifera the function of most genes and loci not clear yet.
|
181. Каскинова М.Д., Ильясов Р.А., Поскряков А.В., Косарев М.Н.,
Шарипов А.Я., Николенко А.Г. Генетические показатели бурзянской
популяции Apis mellifera mellifera L. Биомика. 2016. Т. 8. № 2. С.
117-124.
Каскинова М.Д., Ильясов Р.А., Поскряков А.В., Косарев М.Н., Шарипов
А.Я., Николенко А.Г. Генетические показатели бурзянской популяции Apis
mellifera mellifera L. Биомика. 2016. Т. 8. № 2. С. 117-124. (Kaskinova
M.D., Ilyasov R.A., Poskryakov A.V., Кosarev М.N., Sharipov A.Y.,
Nikolenko A.G. The genetics parametres of the burzyan population of
Apis mellifera mellifera L. (translated). Biomics. 2016. V. 8 (2). P.
117-124.)Для сохранения бурзянской популяции A. m. mellifera необходимо
систематически оценивать ее генетические показатели с целью
предупреждения ее гибридизации с другими подвидами. В данной работе
приведены генетические показатели бурзянской популяции Apis m.
mellifera L., полученные путем анализа полиморфизма локуса COI-COII
мтДНК и микросателлитных локусов яДНК. В результате мы выяснили, что
показатели генетического разнообразия исследуемой выборки пчелиных
семей сопоставимы с соответствующими средними показателями, полученными
в предыдущих исследованиях для бурзянской популяции. Также были
обнаружены две пчелиные семьи гибридного происхождения по ядерному и
митохондриальному геномам в с. Старосубхангулово на территории
Бурзянского района.
To conservation the Burzyan population of Apis mellifera mellifera L.
it is necessary to systematically evaluate its genetic parameters in
order to prevent its hybridization with other subspecies. This paper
present genetic parameters of bee colonies of Burzyan dark forest
honeybee population on the basis of polymorphism analysis of locus
COI-COII mtDNA and nuclear DNA microsatellite loci. As a result, we
found that the parameters of the genetic diversity of studied honeybee
colonies correspond to the average value obtained in previous studies.
The studies of the nuclear and mitochondrial genomes identified two
hybrid origin bee colonies in the protected area of the reserve
“Altyn-Solok”. |
180. Фархутдинов Р. Г., Юмагужин Ф. Г., Ильясов Р. А., Шафикова В. М. ,
Уразбахтина Н. А. Фитоаск - высокое качество зимовки семей, их
весеннего развития и профилактика аскосфероза. Пчеловодство. 2016. №6.
С. 29-32.
Фархутдинов
Р. Г., Юмагужин Ф. Г., Ильясов Р. А., Шафикова В. М. , Уразбахтина Н.
А. Фитоаск - высокое качество зимовки семей, их весеннего развития и
профилактика аскосфероза. Пчеловодство. 2016. №6. С. 29-32.
Farkhutdinov R. G., Yumaguzhin F. G., Ilyasov R. A., Shafikova V. M.,
Urazbakhtina N. A. Fitoask - high quality of wintering and spring
development of honey bee colonies and for the prevention ascosphaerosis
(translated). Russian journal of beekeeping
“Pchelovodstvo”. 2016. No. 6. P. 29-32.
В статье описан опыт осенней и весенней подкормки семей пчел препаратом
«Фитоаск» растительного происхождения. Подкормка
семей пчел
препаратом «Фитоаск» повышает качество зимовки,
поддерживает микробиоценоз кишечника, снижает заболеваемость
аскосферозом, стимулирует весеннее развитие и повышает продуктивность.
The article describes the experience of spring and autumn feeding the
honeybee colonies by medicinal plant extract "Fitoask". Feeding the
honeybee colonies by medicinal plant extract "Fitoask" improves the
quality of wintering, supports intestinal microbiocenosis, reduces the
ascosphaerosis, stimulates the spring development and increases the
honey productivity. |
179. Каскинова М. Д., Ильясов Р. А., Косарев М. Н., Поскряков А. В.,
Шарипов А. Я., Николенко А. Г. Оценка чистопородности семей темной
лесной пчелы бурзянской популяции. Пчеловодство. 2016. №6. С. 20-23.
Каскинова
М. Д., Ильясов Р. А., Косарев М. Н., Поскряков А. В., Шарипов А. Я.,
Николенко А. Г. Оценка чистопородности семей темной лесной пчелы
бурзянской популяции. Пчеловодство. 2016. №6. С. 20-23.
Kaskinova M.D., Ilyasov R.A., Poskryakov A.V., Kosarev M.N., Sharipov
A.Y., Nikolenko A.G. The assessment of the breed of the dark european
bees colonies from the burzyan population (translated). Russian journal
of beekeeping “Pchelovodstvo”. 2016. No. 6. P.
20-23.
Для принятия обоснованных решений по сохранению и управлению природной
популяцией медоносной пчелы необходимо обладать актуальной информацией
о состоянии ее генофонда. В данной работе проведена оценка генетических
показателей пчелиных семей бурзянской популяции темной лесной пчелы
Apis mellifera mellifera L. на основе анализа полиморфизма локуса
COI-COII мтДНК и микросателлитных локусов яДНК. В результате
проведенных исследований выявлены две завезенные пчелиные семьи
гибридного происхождения в селе Старосубхангулово. Своевременное
выявление пчелиных семей гибридного происхождения —
обязательное
условие сохранения генофонда чистопородных популяций темной лесной
пчелы.
To make well-grounded decisions on conservation and management of
natural populations of honey bee, we need to have the current
information about the status of its gene pool. In this study we
evaluated genetic parameters of bee colonies of Burzyan dark forest
honeybee population of Apis mellifera mellifera L. on the basis of
polymorphism analysis locus COI-COII mtDNA and nuclear DNA
microsatellite loci. The studies of the nuclear and mitochondrial
genomes identified two hybrid origin bee colonies. Timely detection of
hybrid colonies will increase the chances of genetic conservation of
native populations of the dark forest bees. Keywords: honey bee Apis
mellifera L., Burzyan dark forest honeybee population, monitoring,
genetic polymorphism microsatellites. |
178. Ильясов Р. А., Поскряков А. В., Петухов А. В., Николенко А. Г.
Современные резерваты темной лесной пчелы на Урале и в Поволжье //
Пчеловодство. 2016. № 5. С. 20-22.
Ильясов
Р. А., Поскряков А. В., Петухов А. В., Николенко А. Г. Современные
резерваты темной лесной пчелы на Урале и в Поволжье // Пчеловодство.
2016. № 5. С. 20-22.
Ilyasov R. A., Poskryakov A. V., Petukhov A. V., Nikolenko A. G. The
current reserves of the dark European honey bee A. m. mellifera in the
Ural and Volga region (translation) // Russian journal of beekeeping
“Pchelovodstvo”. 2016. No. 5. P. 20-22.
Нами было проведено молекулярно-генетическое исследование локальных
популяций темной лесной пчелы A. m. mellifera 49 районов Урала и
Поволжья в сравнении с локальными популяциями пчел южных подвидов A. m.
caucasica и A. m. carpatica на основе анализа полиморфизма 9
микросателлитных локусов Ap243, 4a110, A24, A8, A43, A113, A88, Ap049 и
A28 и локуса COI-COII мтДНК. На территории Урала и Поволжья нами
выделены 5 сохранившихся резерватов (локальных популяций) темной лесной
пчелы A. m. mellifera: бурзянская (горно-лесная зона Республики
Башкортостан), татышлинская (Север Республики Башкортостан),
южно-прикамская (Юг и Центр Пермского края), вишерская (Север Пермского
края), камбарская (Юг и Центр Республики Удмуртия).
We have carried out the molecular genetic research of the dark European
bee A. m. mellifera local population belonging to M lineage in 49
districts of Ural and Volga region in comparison with southern
subspecies of A. m. caucasica and A. m. carpatica local populations.
The genetic research were carried out using 9 microsatellite loci
Ap243, 4a110, A24, A8, A43, A113, A88, Ap049 and A28 of nuclear DNA and
COI-COII loci of mtDNA. Five remaining reserves of the dark European
bees A. m. mellifera were have been identified in the Ural and Volga
region: burzyanskaya (mountain-forest zone of the Republic of
Bashkortostan), tatyshlinskaya (Northern Republic of Bashkortostan),
yuzhno-prikamskaya (Southern and Central Permskii krai), visherskaya
(Northern Permskii krai), kambarskaya (Southern and Central Republic of
Udmurtiya). |
177. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Analysis of the
nucleotide polymorphism of the gene vitellogenin exon 4 and exon 5 of
the honey bees of lineage C (A.m. caucasica, A.m. carpatica) in Russia.
GenBank. 2016. Accession numbers KU146538-KU146557
(http://www.ncbi.nlm.nih.gov).
The
nucleotide sequences of the gene vitellogenin exon 4 and exon 5 of the
honey bees of lineage C (A.m. caucasica, A.m. carpatica) in
Russia. |
176. Ilyasov R.A., Poskryakov A.V., Petukhov A.V., Nikolenko A.G. New
approach to the mitotype classification in Black honeybee Apis
mellifera mellifera and Iberian honeybee Apis mellifera iberiensis.
Russian Journal of Genetics, 2016, V. 52, No. 3, P. 281-291.(IF 0.446).
DOI: 10.1134/S1022795416020058.
The
black honeybee Apis mellifera mellifera L. is today the only subspecies
of honeybee which is suitable for commercial breeding in the climatic
conditions of Northern Europe with long cold winters. The main problem
of the black honeybee in Russia and European countries is the
preservation of the indigenous gene pool purity, which is lost as a
result of hybridization with subspecies, A. m. caucasica, A. m.
carnica, A. m. carpatica, and A. m. armeniaca, introduced from southern
regions. Genetic identification of the subspecies will reduce the
extent of hybridization and provide the gene pool conservation of the
black honeybee. Modern classification of the honeybee mitotypes is
mainly based on the combined use of the DraI restriction endonuclease
recognition site polymorphism and sequence polymorphism of the mtDNA
COI-COII region. We performed a comparative analysis of the mtDNA
COI-COII region sequence polymorphism in the honey bees of the
evolutionary lineage M from Ural and West European populations of black
honeybee A. m. mellifera and Spanish bee A. m. iberiensis. A new
approach to the classification of the honeybee M mitotypes was
suggested. Using this approach and on the basis of the seven most
informative SNPs of the mtDNA COI-COII region, eight honeybee mitotype
groups were identified. In addition, it is suggested that this approach
will simplify the previously proposed complicated mitotype
classification and will make it possible to assess the level of the
mitotype diversity and to identify the mitotypes that are the most
valuable for the honeybee breeding and rearing. |
175. Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г.
Новый подход к классификации митотипов темной лесной пчелы Аpis
mellifera mellifera и иберийской пчелы Аpis mellifera iberiensis.
Генетика. 2016. Т. 52. № 3. С. 320-331. (IF 0.446). DOI:
10.7868/S0016675816020053.
Темная
лесная пчела Apis mellifera mellifera L. является на сегодняшний день
единственным подвидом медоносной пчелы, который пригоден для разведения
в климатических условиях Северной Европы с продолжительными холодными
зимами. Основная проблема темной лесной пчелы в России и странах Европы
- сохранение чистоты аборигенного генофонда, которая теряется в
результате скрещивания с интродуцируемыми из южных регионов подвидами
A. m. caucasica, A. m. carnica, A. m. carpatica и A. m. armeniaca.
Генетическая идентификация подвидов позволит сократить масштабы
гибридизации и сохранить генофонд темной лесной пчелы. Современная
классификация митотипов медоносной пчелы преимущественно основана на
совместном использовании полиморфизма сайтов рестрикции эндонуклеазы
DraI и полиморфизма нуклеотидной последовательности локуса COI_COII
мтДНК. Нами был проведен сравнительный анализ полиморфизма нуклеотидной
последовательности локуса COI_COII мтДНК представителей пчел
эволюционной ветви М уральской и зарубежных европейских популяций
темной лесной пчелы А. m. mellifera, а также иберийской пчелы А. m.
iberiensis. Предложен новый подход к классификации митотипов пчел
эволюционной ветви М, который позволил выделить 8 групп на основе 7
наиболее информативных однонуклеотидных замен (SNP) локуса COI_COII
мтДНК. Данный подход позволит упростить предложенную ранее сложную
классификацию митотипов, оценить уровень митотипического разнообразия,
выявить митотипы, наиболее ценные для селекции и разведения. |
174. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Информативность
митохондриальных генов медоносной пчелы. Пчеловодство. 2016. № 4. С.
20-23.
Ильясов
Р.А., Поскряков А.В., Николенко А.Г. Информативность митохондриальных
генов медоносной пчелы. Пчеловодство. 2016. № 4. С. 20-23.
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. The informativeness of
the mitochondrial genes of the honey bee Apis mellifera. Russian
Journal of Beekeeping “Pchelovodstvo”. 2016. V. 4.
P. 20-23.
Анализ SNP 12 генов митохондриального генома медоносной пчелы позволил
выделить 7 информативных генов, способных дифференцировать подвиды пчел
эволюционных ветвей А, М, С, О. Сравнительный анализ нуклеотидной
последовательности гена ND2 мтДНК 117 образцов пчел 20 подвидов
подтвердил его высокую информативность при дифференциации пчел четырех
эволюционных ветвей.
The SNP analysis of the 12 genes mitochondrial genome honey bee allow
to find 7 informative genes which capable to differentiating subspecies
from evolutionary lineages А, М, С, О. A comparative analysis of the
nucleotide sequence the gene ND2 mtDNA of 117 samples honey bees of 20
subspecies confirmed his highly informative for differentiating the
bees from four evolutionary lineages.. |
173. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Глава: Генетическая
структура популяции темной лесной пчелы А. m. mellifera Урала и
Поволжья. В книге: Роль генетического ресурса медоносных пчел
среднерусской породы в продовольственной и экологической безопасности
России. - Киров: НИИСХ Северо-Востока, 2016. С. 99-102.
Ильясов
Р.А., Поскряков А.В., Николенко А.Г. Глава: Генетическая структура
популяции темной лесной пчелы А. m. mellifera Урала и Поволжья. В
книге: Роль генетического ресурса медоносных пчел среднерусской породы
в продовольственной и экологической безопасности России. - Киров: НИИСХ
Северо-Востока, 2016. С. 99-102. ISBN 978-5-7352-0143-4. 164 с.
(Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. The genetic structure of
the population of the dark European honey bees A. m. mellifera in the
Urals and the Volga region. In: The role of the genetic resources of
the dark European honey bees in the safety of food and environmental of
the Russia. - Kirov: Agricultural Research Institute of the Northeast,
2016. P. 99-102. ISBN 978-5-7352-0143-4. 164 p.)
В исследовании были использованы образцы рабочих пчел из 3123 семей с
493 пасек 49 районов Южного и Среднего Урала и Поволжья, 3 районов
Северного Кавказа и Восточных Карпат, использованных для сравнения в
качестве маркера генофонда популяций южных пчел (А. т. caucasica, А. m.
carpatica).
Исследование проводилось с целью изучения локальных популяций пчел
Урала и Поволжья, оценки их основных генетических характеристик,
анализа уровня интрогрессии и локализация географических границ
сохранившихся резерватов темной лесной пчелы на основе полиморфизма 9
микросателлитных локусов ядерной ДНК и локуса C01-C0II мтДНК.
В результате проведенного популяционно-генетического исследования на
основе полиморфизма 9 микросателлитных локусов ядерной ДНК и 1 локуса
митохондриальной ДНК было показано сохранение 16 локальных популяций
темной лесной пчелы A.m.mellifera. Рассчитанные нами генетические
показатели - гетерозиготность, коэффициенты инбридинга и генетического
родства для этих популяций будут полезны для последующих исследований.
The study used samples of worker bees from 3123 families with 493
apiaries in 49 districts of the Southern and Middle Urals and the Volga
region, 3 areas of the North Caucasus and the Eastern Carpathians, used
for comparison as a marker gene pool of the southern populations of
bees (A. m. Caucasica, A. m. carpatica).
The study was conducted to investigate the local populations of bees of
the Urals and the Volga region, assessing their main genetic
characteristics, analysis of introgression level and localization of
the geographical boundaries of the remaining reserves of dark forest
bee-based polymorphism 9 microsatellite loci and the nuclear DNA loci
C01-C0II mtDNA.
As a result of population-genetic studies based on 9 microsatellite
loci polymorphism of nuclear DNA and mitochondrial DNA locus 1 has been
shown to save 16 local populations A.m.mellifera dark forest bees. The
calculated genetic indicators - heterozygosity coefficients of
inbreeding and genetic relationship of these populations will be useful
for further researches. |
172. Ильясов Р.А., Косарев М.Н., Поскряков А.В., Шарипов А.Я.,
Николенко А.Г. Оценка генетического потенциала темной лесной пчелы.
Пчеловодство. 2016. №2. С. 20-24. (Ilyasov R.A., Kosarev M.N.,
Poskryakov A.V., Sharipov A. Y., Nikolenko A.G. The assessment of
genetic potential of colonies of dark european bees. Russian Journal of
Beekeeping. 2016. V. 2. P. 20-24.).
По
результатам анализа уровня интрогрессии и оценки уровня средней
гетерозиготности, определенного по данным полиморфизма девяти
микросателлитных локусов, показана возможность выявления пчелиных семей
с оптимальным генетическим потенциалом. Генетический потенциал пчел,
обитающих в естественных и искусственных дуплах (бортях и колодах) в
дикой природе, поддерживается эффективнее по сравнению с семьями,
разводимыми на пасеках.
We have shown the ability to identify bee colonies with the best
genetic potential. We found that the genetic potential of bee colonies,
nesting in in natural and artificial tree trunks (bort and koloda) and
inhabiting in the wild nature, maintain more effective than colonies in
commercial beehives on apiaries using the analysis of the level of
introgression of southern genes and assess the level of average
heterozygosity according based on polymorphism of 9 microsatellite
loci. Keywords: Apis mellifera mellifera, dark European bee, tree
hollow nesting dark bee, Burzian ecotype of European bee, genetic
diversity of bee colonies, the introgression of southern genes, the
optimal genetic potential of bee colonies, the preservation of the
genetic diversity, hybridization of subspecies. |
171. Ilyasov R.A., Farkhutdinov R.G. Chapter 2. Herbal Dietary
Supplement with Antifungal Effect for Increasing the Productivity of
Honey Bee Colonies. In: Honeybees: biology, behavior and benefits,
Editor: Daniaele Dreesen. Hauppauge, New York: Nova Science Publishers,
Inc., 2016. P. 15-22. ISBN: 978-1-63484-051-4 (e-book edition). ISBN:
978-1-63484-037-8 (hardcopy edition). 149 pp.
The
advantages of using for feeding the honey bees by sugar syrup with
ethanol extract from 15 medicinal plants were presented in the article.
This extract has immunomodulatory effect on honey bees and has
antifungal activity against pathogenic fungus Ascosphaera apis. Feeding
by sugar syrup with the extract was led to a stability of wintering,
was increased a productivity of honey and eggs in comparison with the
control group. Antifungal activity of the extract against
ascosphaerosis was similar with activity of the nystatin.
Immunomodulatory effect of the extract on honey bees was similar with
effect of Rhodiola rosea. |
170. Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Chapter 1. The
Genetic Structure of Dark European Honey Bee Population in the Ural.
In: Honeybees: biology, behavior and benefits, Editor: Daniaele
Dreesen. Hauppauge, New York: Nova Science Publishers, Inc., 2016. P.
1-13. ISBN: 978-1-63484-051-4 (e-book edition). ISBN: 978-1-63484-037-8
(hardcopy edition). 149 pp.
The
beekeepers in Russia and Europe have been introducing bees from the
southern regions to the northern ones for the last two centuries.
Eventually the genetic pool of the dark European bee subspecies Apis
mellifera mellifera L. was extensive hybridized. We analyzed the
polymorphism of the mitochondrial (mtDNA COI–COII intergenic
locus) and nuclear (two microsatellite loci, ap243 and 4a110) DNA
markers in order to prove the preservation of the native bee population
in the Urals, in the Republic of Bashkortostan, and the Perm Krai. Four
local populations of the dark European honey bee A.m.mellifera
surviving in the Urals have been identified and their principal genetic
characteristics have been determined. The data of the genetic structure
and geographical localization of the area of the dark European bee
local populations in the Urals may be used in the restoring the damaged
genetic pool of A.m.mellifera in Russia and other northern countries. |
169. Ильясов Р.А., Поскряков А.В., Салтыкова Е.С., Николенко А.Г. Глава
5.12. Диагностика темной лесной пчелы башкирской популяции на основе
полиморфизма гена вителлогенина Vg. В книге: Темная лесная пчела Apis
mellifera mellifera L. Республики Башкортостан / отв. ред. Р.А.
Ильясов, А.Г. Николенко, Н.М. Сайфуллина. – Уфа: Гилем,
Башкирская энциклопедия, 2015. С. 265-274. ISBN: 978-5-88185-264-1. 308
с. (Ilyasov R.A., Poskryakov A.V., Saltykova E.S., Nikolenko A.G.
Chapter 5.12. Identification of dark forest bees of the Bashkir
population, based on vitellogenin gene (Vg) polymorphism. In: Dark
forest bee Apis mellifera mellifera L. of the Republic of
Bashkortostan. Eds. R.A. Ilyasov, A.G. Nikolenko, N.M. Saifullina. -
Ufa: Gilem, Bashkirskaya encilopedia, 2015. 265-274 pp. ISBN:
978-5-88185-264-1. 308 p.).
Сравнительный
анализ нуклеотидной последовательности гена вителлогенина Vg может быть
полезен в филогенетических реконструкциях представителей вида
A.mellifera, а обнаруженные 26 позиций SNP могут использоваться в
качестве генетических маркеров, дифференцирующих пчел эволюционных
ветвей М и С, в селекции чистых линий A.m.mellifera, в проведении
генетического штрихкодирования и создании генетического паспорта семей.
Comparative analysis of the nucleotide sequence of the gene
vitellogenin Vg may be useful in phylogenetic reconstructions of a
species A.mellifera, and found 26 products SNP can be used as genetic
markers, differentiating bee evolutionary branches of M and C, in the
selection of pure lines A.m.mellifera, to conduct genetic barcoding and
the creation of a genetic passport families. |
168. Ильясов Р.А., Поскряков А.В.,Петухов А.В., Николенко А.Г. Глава
5.11. Генетическая дифференциация уральской популяции темной лесной
пчелы. В книге: Темная лесная пчела Apis mellifera mellifera L.
Республики Башкортостан / отв. ред. Р.А. Ильясов, А.Г. Николенко, Н.М.
Сайфуллина. – Уфа: Гилем, Башкирская энциклопедия, 2015. С.
255-265. ISBN: 978-5-88185-264-1. 308 с. (Ilyasov R.A., Poskryakov
A.V., Petukhov A.V., Nikolenko A.G. Chapter 5.11. Genetic
differentiation of the Ural population of the dark forest bees. In:
Dark forest bee Apis mellifera mellifera L. of the Republic of
Bashkortostan. Eds. R.A. Ilyasov, A.G. Nikolenko, N.M. Saifullina. -
Ufa: Gilem, Bashkirskaya encilopedia, 2015. 255-265 pp. ISBN:
978-5-88185-264-1. 308 p.).
В
результате проведенных генетических исследований на основе анализа
локусов митохондриальной ДНК (COI-COII мтДНК) и ядерной ДНК (два
микросателлитных локуса ap243 и 4a110) популяции темной лесной пчелы
A.m.mellifera на територии Урала - Республика Башкортостан (Южный Урал)
и Пермский край (Средний Урал) - нами были обнаружены четыре островка
сохранившейся популяции темной лесной пчелы: Вишерская,
Южно-Прикамская, Татышлинская и Бурзянская. Мы надеемся, что данные,
полученные в статье, позволят выполнить новые проекты по поиску новых
локализаций сохранившейся популяции темной лесной пчелы A.m.mellifera в
России и других странах. В дальнейшем мы планируем расширить число
анализируемых локусов и территорию исследований.
As a result of genetic research based on analysis of mitochondrial DNA
loci (COI-COII mtDNA) and nuclear DNA (two microsatellite loci and
ap243 4a110) dark forest bee populations A.m.mellifera on the territory
of the Urals - the Republic of Bashkortostan (South Urals) and the Perm
region (the Middle Urals ) - we found four remaining population of the
island dark forest bees: Visherskaya, South Prikamskaya, Tatyshlinskaya
and Burzyan. We hope that the data obtained in this article will help
to fulfill new projects to find new locations remaining population of
dark forest bees A.m.mellifera in Russia and other countries. In the
future we plan to expand the number of analyzed loci and area studies. |
167. Ильясов Р.А., Шареева З.В., Николенко А.Г. Глава 5.10.
Генетическая структура северной башкирской популяции темной лесной
пчелы. В книге: Темная лесная пчела Apis mellifera mellifera L.
Республики Башкортостан / отв. ред. Р.А. Ильясов, А.Г. Николенко, Н.М.
Сайфуллина. – Уфа: Гилем, Башкирская энциклопедия, 2015. С.
243-255. ISBN: 978-5-88185-264-1. 308 с. (Ilyasov R.A., Shareeva Z.V.,
Nikolenko A.G. Chapter 5.10. Genetic structure of of northern
population of native dark forest bees. In: Dark forest bee Apis
mellifera mellifera L. of the Republic of Bashkortostan. Eds. R.A.
Ilyasov, A.G. Nikolenko, N.M. Saifullina. - Ufa: Gilem, Bashkirskaya
encilopedia, 2015. 243-255 pp. ISBN: 978-5-88185-264-1. 308 p.).
Популяция
северного ареала башкирской пчелы A.m.mellifera характеризуется
устойчивым соотношением внутри- и межгрупповой компонент генного
разнообразия, что отражает баланс процессов интеграции и дифференциации
видового генофонда. Данное равновесное соотношение может сохраняться
только при стабильных значениях популяционных характеристик
(F-коэффициенты и гетерозиготность) на исторически сложившемся
оптимальном уровне.
Анализ структуры популяции медоносной пчелы северного ареала Республики
Башкортостан по морфометрическим данным показал наличие 79% пасек с
содержанием семей А.m.mellifera и 21% - с присутствием гибридных
пчелиных семей.
Кластерный анализ по данным морфометрических исследований экстерьерных
признаков позволил отнести популяцию медоносной пчелы северного ареала
Республики Башкортостан (Бирский, Мишкинский, Караидельский районы) к
подвиду A.m.mellifera.
The population of the northern area of the Bashkir bee A.m.mellifera
characterized by steady ratio of intra- and inter-group component of
genetic diversity, which reflects the balance of the processes of
integration and differentiation of species gene pool. This equilibrium
relationship can only be maintained with stable values of population
characteristics (F-ratios and heterozygosity) on historical optimum
level.
Analysis of the structure of the honey bee population of the northern
area of the Republic of Bashkortostan morphometry showed the presence
of 79% of apiaries containing A.m.mellifera families and 21% - with the
presence of hybrid bee colonies.
Cluster analysis according to morphometric studies exterior signs
allowed to carry the honey bee population of the northern area of the
Republic of Bashkortostan (Birsky, Mishkinskoye, Karaidelsky District)
to the subspecies A.m.mellifera. |
166. Николенко А.Г., Ильясов Р.А., Поскряков А.В. Глава 5.6. Ареал
бурзянской популяции темной лесной пчелы. В книге: Темная лесная пчела
Apis mellifera mellifera L. Республики Башкортостан / отв. ред. Р.А.
Ильясов, А.Г. Николенко, Н.М. Сайфуллина. – Уфа: Гилем,
Башкирская энциклопедия, 2015. С. 218-227. ISBN: 978-5-88185-264-1. 308
с. (Nikolenko A.G., Ilyasov R.A., Poskryakov A.V. Chapter 5.6. The area
of distribution of Burzyan dark forest bees. In: Dark forest bee Apis
mellifera mellifera L. of the Republic of Bashkortostan. Eds. R.A.
Ilyasov, A.G. Nikolenko, N.M. Saifullina. - Ufa: Gilem, Bashkirskaya
encilopedia, 2015. 218-227 pp. ISBN: 978-5-88185-264-1. 308 p.).
Показано
генетическое родство (разной степени) бортевых пчел с пасечными
пчелиными семьями в пределах ареала популяции. Генетические процессы
между ними требуют отдельного обсуждения. Генетическая уникальность как
бортевой, так и бурзянской популяции в целом предполагалась многими
авторами, однако нам впервые удалось показать на подробном
экспериментальном материале генетическую дифференциацию бурзянской
популяции от большинства популяций Урала и Поволжья.
Полученные результаты позволяют предполагать существование двойной
генетической границы ареала, которая должна быть присуща естественной
(длительно существующей) популяции медоносной пчелы в силу
биологических особенностей вида: радиус удаления от семьи матки и
трутней во время спаривания может достигать 12 км, дальность полета
пчелиного роя - 40 км и более. Впрочем, двойная генетическая граница
должна быть свойственна и популяциям многих видов с протяженным
сплошным ареалом.
Показано существование естественного интенсивного трутневого фона -
третьего (не по значимости) механизма, определяющего генетическую
стабильность естественной популяции, помимо изоляции и социального
фактора, известных ранее: активное ядро генофонда популяции формирует
краевые зоны, которые, в свою очередь, защищают это ядро. Таким
образом, помимо искусственных технологий - популяции закрытого типа и
принципа двойной замены маток - возможна стратегия естественного
сохранения генофонда медоносной пчелы, дающая более стабильный
результат.
Displaying the genetic relationship (of varying degrees) board with bee
bee bee families within the range of the population. Genetic processes
between them require a separate discussion. Genetic uniqueness as
wild-hive and Burzyan the general population assumed by many authors,
but the first time we were able to show the detailed experimental data
on genetic differentiation Burzyan populations of most populations of
the Volga region and the Urals.
These results suggest the existence of a double genetic boundaries of
the area, which should be inherent in the natural (continuous current)
population of honey bees due to the biological characteristics of
species: the radius of the distance from the family of the uterus and
the drones during mating can be up to 12 km range beehive - 40 km and
more. However, the double border must be a genetic characteristic of
many species and populations with an extended continuous habitat.
The existence of natural background of intense drone - the third (not
least) the mechanism that determines the genetic stability of the
natural populations, in addition to isolation and social factor,
previously known: the active nucleus of the gene pool of the population
forms the boundary zone, which, in turn, protect this core. Thus, apart
from artificial technologies - the population of the closed type and
the principle of dual replacement queens - a possible strategy of the
natural preserve the gene pool of the honey bee, which gives a more
stable result.. |
165. Фархутдинов Р.Г., Ильясов Р.А., Юмагужин Ф.Г., Уразбахтина Н.А.,
Туктарова Ю.В., Шафикова В.М., Абдуллин М.Ф. Глава 4.7. Применение
фитосбора для лечения аскосфероза темной лесной пчелы башкирской
популяции. В книге: Темная лесная пчела Apis mellifera mellifera L.
Республики Башкортостан / отв. ред. Р.А. Ильясов, А.Г. Николенко, Н.М.
Сайфуллина. – Уфа: Гилем, Башкирская энциклопедия, 2015. С.
163-176. ISBN: 978-5-88185-264-1. 308 с. (Farkhutdinov R.G., Ilyasov
R.A., Yumaguzhin F.G. , Urazbakhtina N.A., Tuktarova Y.V., Shafikova
V.M., Abdullin M.F. Chapter 4.7. The use of drugs on the basis of
phytoextracts (extracts of drug plants) against ascospaerosis
(Ascospaera apis) in the native population of dark forest bees. In:
Dark forest bee Apis mellifera mellifera L. of the Republic of
Bashkortostan. Eds. R.A. Ilyasov, A.G. Nikolenko, N.M. Saifullina. -
Ufa: Gilem, Bashkirskaya encilopedia, 2015. 163-176 pp. ISBN:
978-5-88185-264-1. 308 p.).
Изучены
фунгицидные свойства созданного авторами растительного сбора
по
отношению к Ascosphaera apis. Обсуждается возможность использования
сбора в профилактике и лечение аскосфероза. В ходе проведения
масс-спектрометрического анализа химического состава экстрактов
растительного сбора, установлены вещества, предположительно обладающие
фунгицидной активностью. На основе сравнения зон задержки роста
возбудителя аскосфероза in vitro установлена фунгицидная
активность лекарственных трав и фитосбора. Обнаружено
увеличение
активности ферментов каталазы и пероксидазы в кишечнике и инвертазы в
глоточных железах зимующих пчел под влиянием подкормки сиропа с
экстрактом растительного сбора, что является показателем повышения
зимостойкости пчелиных семей. В производственных опытах показано, что
подкормка пчелиных семей сиропом с экстрактом растительного сбора
оказывает положительное влияние на зимовку, весеннее развитие и
продуктивность пчелиной семьи.
Studied the fungicidal properties of the plant collection was created
by the authors with respect to Ascosphaera apis. The possibility of
using the collection in the prevention and treatment of askosferoza. In
the course of mass spectrometric analysis of the chemical composition
of vegetable extracts collecting installed substances thought to have
fungicidal activity. Based on the comparison of zones of growth
inhibition in vitro pathogen askosferoza set fungicidal activity of
herbs and fitosbora. An increase in the activity of catalase and
peroxidase enzymes in the gut and in the pharyngeal glands of invertase
wintering bees under the influence of feeding syrup with an extract of
the plant collection, which is an indicator of increasing hardiness of
bee colonies. The industrial experience has shown that feeding of bee
colonies syrup with an extract of the plant collection has a positive
effect for the winter, spring development and productivity of the bee
colony. |
164. Ильясов Р.А., Косарев М.Н., Юмагужин Ф.Г. Глава 1.5. Современная
популяция бурзянской бортевой темной лесной пчелы на Южном Урале. В
книге: Темная лесная пчела Apis mellifera mellifera L. Республики
Башкортостан / отв. ред. Р.А. Ильясов, А.Г. Николенко, Н.М. Сайфуллина.
– Уфа: Гилем, Башкирская энциклопедия, 2015. С. 27-33. ISBN:
978-5-88185-264-1. 308 с. (Ilyasov R.A., Kosarev M.N., Yumaguzhin F.G.
Chapter 1.5. The modern population of Burzyan wild-hive dark forest
bees in the southern Urals. In: Dark forest bee Apis mellifera
mellifera L. of the Republic of Bashkortostan. Eds. R.A. Ilyasov, A.G.
Nikolenko, N.M. Saifullina. - Ufa: Gilem, Bashkirskaya encilopedia,
2015. 27-33 pp. ISBN: 978-5-88185-264-1. 308 p.).
Бурзянская
бортевая темная лесная пчела A.m.mellifera представляет большой интерес
для пчеловодов и ученых европейских стран, так как по ней можно сделать
реконструкцию естественной истории пчел. В 2011 г. на основании заявки
НИИ пчеловодства и государственного заповедника
«Шульган-Таш» пчелы этой популяции выделены как
селекционное достижение в отдельный породный тип «Бурзянская
бортевая пчела».
Burzyan tree hollow dark forest bee A.m.mellifera of great interest to
beekeepers and scholars of European countries, as it can be done on the
reconstruction of the natural history of bees. In 2011, upon the
request of the Research Institute of apiculture and the State Reserve
"Shulgan-Tash" bee this population identified as a breeding achievement
as a separate breed type "Burzyan wild-hive bee.". |
163. Ильясов Р. А., Николенко А. Г., Сайфуллина Н. М. Темная лесная
пчела Apis mellifera mellifera L. Республики Башкортостан / отв. ред.
Р.А. Ильясов, А.Г. Николенко, Н.М. Сайфуллина. – Уфа: Гилем,
Башкирская энциклопедия, 2015. – 308 с. ISBN:
978-5-88185-264-1.
(Ilyasov R.A., Nikolenko A.G., Saifullina N.M. Dark forest bee Apis
mellifera mellifera L. of the Republic of Bashkortostan. Eds. R.A.
Ilyasov, A.G. Nikolenko, N.M. Saifullina. - Ufa: Gilem, Bashkirskaya
encilopedia, 2015. - 308 p. ISBN: 978-5-88185-264-1.).
Коллективная
монография представляет собой собрание теоретических и
экспериментальных работ сотрудников научных центров Республики
Башкортостан, занимающихся решением задач по сохранению генофонда
башкирской популяции темной лесной пчелы. Для преподавателей,
студентов, научных сотрудников, пчеловодов в качестве
учебно-методического пособия, научно-практического руководства и
справочника в области пчеловодства.
The collective monograph is a collection of theoretical and
experimental studies of scientists of different scientifi c centers of
the Republic of Bashkortostan involved in problems of gene pool
preservation of the dark forest bee of Bashkir population. It is
recommended for teachers, students, researchers, beekeepers as
scientific and practical manual, guide and reference book in the field
of beekeeping. |
162. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Анализ
информативности митохондриальных генов в филогенетических исследованиях
медоносной пчелы Apis mellifera. Биомика. Т. 7. № 3. 2015. С. 192-205.
Ильясов
Р.А., Поскряков А.В., Николенко А.Г. Анализ информативности
митохондриальных генов в филогенетических исследованиях медоносной
пчелы Apis mellifera. Биомика. Т. 7. № 3. 2015. С. 192-205.
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Analisys of the
informativeness of the mitochondrial genes in phylogenetics researches
of the honey bee Apis mellifera. Biomics. V. 7 (3). 2015. P. 192-205.
Проведен сравнительный анализ нуклеотидной последовательности 12 генов
митохондриального генома медоносной пчелы, на основании которого
удалось выделить 7 информативных генов, позволяющих дифференцировать
подвиды пчел эволюционных ветвей А, М, С, О. На примере использования
сравнительного анализа нуклеотидной последовательности гена ND2 мтДНК
на статистически значимом объеме выборки мы показали высокий уровень
дифференцирующей способности этого гена и предположили возможность
отдельного использования каждого из 7 генов для дифференциации подвидов
4 эволюционных ветвей.
Seven informative genes of the honey bee Apis mellifera, which allow
differentiating subspecies from evolutionary lineages А, М, С, О, were
found based on the comparative analysis of 12 genes mitochondrial
genome. We had showed the high level differentiate ability of the gene
ND2 mtDNA by comparative analysis of the sequences this gene on
statistically significant size of sample of the honey bees. We
suggested that each one from the seven informative genes can be used
for differentiation the subspecies of the honey bees from evolutionary
lineages А, М, С, О. |
161. Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Aнализ
состояния генофонда современной популяции темной лесной пчелы A. m.
mellifera Урала и Поволжья. Биомика. Т. 7. № 3. 2015. С. 167-191.
Ильясов
Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Aнализ состояния
генофонда современной популяции темной лесной пчелы A. m. mellifera
Урала и Поволжья. Биомика. Т. 7. № 3. 2015. С. 167-191.
Ilyasov R.A., Poskryakov A.V., Petukhov A.V., Nikolenko A.G. The gene
pool analisys of the current population of the dark European honey bee
A. m. mellifera in the Ural and Volga region. Biomics. V. 7 (3). 2015.
P. 167-191.
Нами было проведено молекулярно-генетическое исследование локальных
популяций темной лесной пчелы A. m. mellifera эволюционной ветви М 49
районов Урала и Поволжья в сравнении с локальными популяциями пчел
южных подвидов A. m. caucasica и A. m. carpatica эволюционной ветви С 3
районов Северного Кавказа и Восточных Карпат на основе анализа
полиморфизма 9 микросателлитных локусов Ap243, 4a110, A24, A8, A43,
A113, A88, Ap049 и A28 ядерной ДНК и локуса COI-COII мтДНК. Мы
обнаружили на территории 16 районов Урала и Поволжья сохранившиеся
резерваты аборигенной темной лесной пчелы A. m. mellifera с
гибридизацией менее 5%. В популяциях пчел на территории 8 районов Урала
и Поволжья наблюдалась умеренная гибридизация до 20%. На территории
Урала и Поволжья нами выделены 5 сохранившихся резерватов (популяций)
темной лесной пчелы A. m. mellifera: бурзянская (горно-лесная зона
Республики Башкортостан), татышлинская (Север Республики Башкортостан),
южно-прикамская (Юг и Центр Пермского края), вишерская (Север Пермского
края), камбарская (Юг и Центр Республики Удмуртия). Эти пять популяций
составляют основу генофонда темной лесной пчелы Урала и Поволжья.
Основной массив сохранившегося аборигенного генофонда A. m. mellifera
(ядро генофонда популяции A. m. mellifera) располагается на территории
всего Пермского края и Севера Республики Башкортостан. Для популяции
пчел A. m. mellifera Урала и Поволжья были рассчитаны средние значения
гетерозиготности (Hо = 0,340 ± 0,037, Hs = 0,357
± 0,032,
Ht = 0,421 ± 0,037), коэффициенты инбридинга (Fis = 0,081
± 0,037, Fit = 0,196 ± 0,042, Fst = 0,125
±
0,023), коэффициенты родства (R = 0,210 ± 0,034). Данные
генетические стандарты популяции темной лесной пчелы A. m. mellifera
Урала и Поволжья будут полезны для последующих популяционных
исследований медоносной пчелы в России и Европе.
We have carried out the molecular genetic research of the dark European
bee A. m. mellifera local population belonging to M lineage in 49
districts of Ural and Volga region in comparison with southern
subspecies of A. m. caucasica and A. m. carpatica local populations
belonging to C lineage in 3 districts of Northern Caucasus and
Carpathians region. The genetic research were carried out using 9
microsatellite loci Ap243, 4a110, A24, A8, A43, A113, A88, Ap049 and
A28 of nuclear DNA and COI-COII loci of mtDNA. We have discovered low
level less to 5% introgression populations of the dark European bee A.
m. mellifera in 16 districts of Ural and Volga region. Introgression to
20% was discovered in populations of the dark European bee A. m.
mellifera in 8 districts of Ural and Volga region. Five remaining
reserves of the dark European bees A. m. mellifera were have been
identified in the Ural and Volga region: burzyanskaya (mountain-forest
zone of the Republic of Bashkortostan), tatyshlinskaya (Northern
Republic of Bashkortostan), yuzhno-prikamskaya (Southern and Central
Permskii krai), visherskaya (Northern Permskii krai), kambarskaya
(Southern and Central Republic of Udmurtiya). These five populations
have formed the basis of the gene pool of the dark European bee A. m.
mellifera in the Ural and Volga region. The bulk of the surviving
indigenous gene pool of the dark European bee A. m. mellifera (the core
of the gene pool of the population A. m. mellifera) predominantly
located in the Permskii krai and the Republic of Bashkortostan. We have
calculated the average heterozygosity (Hо = 0,340 ± 0,037,
Hs =
0,357 ± 0,032, Ht = 0,421 ± 0,037), coefficients
of
inbreeding (Fis = 0,081 ± 0,037, Fit = 0,196 ±
0,042, Fst
= 0,125 ± 0,023) and coefficient of relatedness (R = 0,210
± 0,034) for the population of the dark European bee A. m.
mellifera of the Ural and Volga region. These genetic standards of the
dark European bee A. m. mellifera of the Ural and Volga region will be
useful for following population researches in Russia and Europe. |
160. Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Новый
подход к классификации митотипов темной лесной пчелы аpis mellifera
mellifera и иберийской пчелы аpis mellifera iberiensis. Генетика. 2016.
Т. 52. № 2. С. 1–12. (IF 0.446).
DOI:10.7868/S0016675816020053.
Ильясов
Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Новый подход к
классификации митотипов темной лесной пчелы аpis mellifera mellifera и
иберийской пчелы аpis mellifera iberiensis. Генетика. 2016. Т. 52. № 2.
С. 1–12. (IF 0.446). DOI:10.7868/S0016675816020053
Ilyasov R.A., Poskryakov A.V., Petukhov A.V., Nikolenko A.G. A new
approach to the classification of mitotypes of dark European bees Apis
mellifera mellifera and Iberian bees Apis mellifera iberiensis. Russian
journal of genetics. 2016. V. 52 (2). P. 1–12. (IF 0.446).
DOI:
10.7868/S0016675816020053.
Темная лесная пчела Apis mellifera mellifera L. является на сегодняшний
день единственным подвидом медоносной пчелы, который пригоден для
разведения в климатических условиях Северной Европы с продолжительными
холодными зимами. Основная проблема темной лесной пчелы в России и
странах Европы – сохранение чистоты аборигенного генофонда,
которая теряется в результате скрещивания с интродуцируемыми из южных
регионов подвидами A. m. caucasica, A. m. carnica, A. m. carpatica и A.
m. armeniaca. Генетическая идентификация подвидов позволит сократить
масштабы гибридизации и сохранить генофонд темной лесной пчелы.
Современная классификация митотипов медоносной пчелы преимущественно
основана на совместном использовании полиморфизма сайтов рестрикции
эндонуклеазы DraI и полиморфизма нуклеотидной последовательности локуса
COI COII мтДНК. Нами был проведен сравнительный анализ полиморфизма
нуклеотидной последовательности локуса COI COII мтДНК представителей
пчел эволюционной ветви М уральской и зарубежных европейских популяций
темной лесной пчелы А. m. mellifera, а также иберийской пчелы А. m.
iberiensis. Предложен новый подход к классификации митотипов пчел
эволюционной ветви М, который позволил выделить 8 групп на основе 7
наиболее информативных однонуклеотидных замен (SNP) локуса COI COII
мтДНК. Данный подход позволит упростить предложенную ранее сложную
классификацию митотипов, оценить уровень митотипического разнообразия,
выявить митотипы, наиболее ценные для селекции и разведения.
The article provides a comparative analysis of the nucleotide sequence
polymorphism of loci COI- COII mtDNA representatives bee evolutionary
lineage M of Ural and foreign European populations of dark European
bees A. m. mellifera, and the Iberian bees A. m. iberiensis. We have
proposed a new mitotypic classification of dark European bees and
Iberian bees of evolutionary lineage M, based on an analysis of eight
of the most informative SNP. This classification will allow to estimate
the level of mitotypic diversity of the whole population of dark
European and the Iberian bees, to preserve and maintain the level of
mitotypic diversity, to recognize most important mitotypes for the
selection and breeding.
. |
159. Фархутдинов Р.Г., Ильясов Р.А., Уразбахтина Н.А., Туктарова Ю.В.,
Шафикова В.М., Абдуллин М.Ф. Определение и стандартизация биологически
активных веществ биологического стимулятора продуктивности пчелиной
семьи с фунгицидной активностью. Материалы Всероссийской
научно-практической конференции с международным участием "Инновационные
технологии в пчеловодстве и проблемы сохранения генофонда медоносных
пчел". 22 апреля 2015. Уфа: БГАУ. 2015. С. 190-195. (R.G.Farkhutdinov,
R.A. Ilyasov, N.A. Urazbakhtina, Y.V. Tuktarova, V.M. Shafikova, M.F.
Abdullin DEFINING AND STANDARDIZING BIOLOGICALLY ACTIVE SUBSTANCES
BIOLOGICAL STIMULATOR PRODUCTIVITY OF BEE FAMILY FUNGICIDAL ACTIVITY.
Proceedings of the russian international conference "Innovation
technology in beekeeping and problem of saving the gene pool". 22 april
2015. Ufa. P. 190-195.).
Аннотация:
Аскосфероз – инфекционная болезнь пчелиной семьи, вызываемая
паразитическим грибком Ascosphaera apis. Аскосфероз подавляет развитие
пчелиной семьи и может привести к гибели при отсутствии лечения и
стимуляции иммунитета. Химические препараты с фунгицидным действием
очень эффективны в борьбе с аскосферозом, но обладают побочными
действиями. В данной статье мы описали препарат
«Фитоаск»,
представляющий собой спиртовый экстракт растительного сбора, обладающий
одновременно фунгицидным и стимулирующим эффектом для пчелиной семьи.
Применение этого препарата может повысить продуктивность пчелиной семьи
и снизить затраты на ее содержание.
Ключевые
слова: Apis mellifera mellifera, Ascosphaera apis, аскосфероз,
медоносная пчела, фунгицид, «Фитоаск».
Abstract:
Ascosphaerosis - infectious disease of bees caused by a parasitic fungus
Ascosphaera apis. Ascosphaerosis suppresses the development of bee
colonies and
can lead to death if untreated and stimulation of immunity. Chemicals
with fungicidal
action are very effective in combating аscosphaerosis, but they have
side effects. In
this article we describe the drug «Fitoask», which
is a collection of alcoholic extract
of plant that has both fungicidal and stimulating effect for the bee
colony. Its use can
increase the productivity of the bee families and reduce the cost of
its maintenance.
Keywords: Apis mellifera mellifera, Ascosphaera apis, аscosphaerosis,
honey bee, a
fungicide, «Fitoask». |
158. Ilyasov R.A., Kosarev M.N., Neal A., Yumaguzhin F.G. Dunkle bienen
im sudlichen Ural. Deutsches Bienen Journal. 2015. V. 9. P. 48-51.
Бурзянская
бортевая пчела и бортевое пчеловодство на Южном Урале (Burzyan
wild-hive honeybee and wild-hive beekeeping in South Ural)
A spontaneous hybridization among honeybees in most European countries
has led to the loss in the gene pool of the dark European honeybee. We
believe Russia still has a considerable array of purebred populations
of European dark bees A. m. mellifera. The commonest bee, the Burzyan
Honey Bee, live under protection in the mountain forest zone of South
Ural in the State Nature Biosphere Reserve
«Shulgan-Tash»,
regional nature reserve «Altyn Solok» and National
Park
«Bashkortostan». These Wild Tree Hollow Honeybees
are of
great interest among beekeepers and scientists around the world, as
they could be used to make a reconstruction of the natural history of
bees.
На современном этапе развития пчеловодства в Евразии, на фоне массовой
гибридизации подвидов пчел и потери генофонда темной лесной
(среднеевропейской) пчелы в большинстве стран Европы, Россия
располагает значительными массивами чистопородных популяций темной
лесной пчелы A. m. mellifera. Наиболее известная популяция –
бурзянская бортевая пчела – сохраняется в условиях бортевого
пчеловодства, дикого обитания и пасек с рамочными ульями в горно-лесной
зоне Южного Урала на территории государственного природного биосферного
заповедника «Шульган-Таш», регионального природного
заказника «Алтын Солок» и национального парка
«Башкирия». Дикие и бортевые пчелы представляют
большой
интерес для пчеловодов и ученых всего мира, так как по ним можно
сделать реконструкцию естественной истории пчел.
Die Verkreuzung von Rassen der Honigbiene hat in den meisten
europäischen Ländern zu einer Verarmung des Genpools
der
Dunklen Europäischen Biene Apis mellifera mellifera
geführt.
Wir glauben, dass es in Russland noch immer reine Populationen dieser
Bienenrasse gibt. Die hier häufigste Dunkle Biene, die
Burzyanische Biene, ist in den Waldregionen des südlichen Ural
in
mehreren Reservaten unter Schutz gestellt.Diese in Baumhöhlen
nistenden Bienen sind für die Erforschung der Naturgeschichte
der
Honigbienen von besonderem Interesse.
Ilyasov R.A., Kosarev M.N., Neal A., Yumaguzhin F.G. Dunkle bienen im
sudlichen Ural. Deutsches Bienen Journal. 2015. V. 9. P. 48-51. |
157. Ильясов Р.А., Косарев М.Н., Поскряков А.В., Шарипов А.Я.,
Николенко А.Г. Новый подход к оценке генетического потенциала семей
темной лесной пчелы Apis mellifera mellifera на основе полиморфизма
микросателлитных локусов. Биомика. 2015. Т. 7. № 2. C. 138-152.
Ильясов
Р.А., Косарев М.Н., Поскряков А.В., Шарипов А.Я., Николенко А.Г. Новый
подход к оценке генетического потенциала семей темной лесной пчелы Apis
mellifera mellifera на основе полиморфизма микросателлитных локусов.
Биомика. 2015. Т. 7. № 2. C. 138-152.
Ilyasov R.А., Кosarev М.N., Poskryakov A.V., Sharipov A.Y., Nikolenko
A.G. New approach to the assessment of genetic potential of colonies of
dark European bee Apis mellifera mellifera based on polymorphism of
microsatellite loci. Biomics. 2015. V. 7 (2). P. 138-152.
В России и странах Западной и Северной Европы темная лесная
пчела
Apis mellifera mellifera была признана наиболее эффективной для
коммерческого разведения. Ранее пчеловоды северных стран были другого
мнения и ставили массовые эксперименты по интродукции и разведению
подвидов из Южной и Восточной Европы на своих пасеках. Такое развитие
событий привело к массовой интрогрессии генов южных пчел в популяции
темной лесной пчелы и стало результатом потери чистоты аборигенного
генофонда. Для восстановления генофонда темной лесной пчелы в пределах
исторического ареала необходимо проводить селекцию пчелиных семей на
основе генетической стандартизации в сохранившихся изолятах
A.m.mellifera. По результатам анализа уровня интрогрессии южных генов и
оценки уровня средней гетерозиготности по данным полиморфизма 9
микросателлитных локусов мы показали возможность идентификации пчелиных
семей с оптимальным генетическим потенциалом. Мы обнаружили, что
генетический потенциал пчелиных семей, обитающих в естественных и
искусственных дуплах (бортях и колодах) в условиях дикой природы,
поддерживается эффективнее по сравнению с семьями, разводимыми в ульях
на пасеках.
In Russia and the countries of Western and Northern Europe dark
European bee Apis mellifera mellifera has been recognized as the most
effective for commercial breeding. Earlier beekeepers of Nordic
countries were of a different opinion and put massive experiments on
the introduction and breeding subspecies of the Southern and Eastern
Europe in their apiaries. This development led to massive introgression
of genes of bees from southern populations into dark European bees.
Therefore they lost of the purity of the aboriginal gene pool. For
restore the gene pool of the dark European bees within the historic
range is necessary selection of colonies based on the genetic
standardization in the preserved isolates of A.m.mellifera. We have
shown the ability to identify bee colonies with the best genetic
potential. We found that the genetic potential of bee colonies, nesting
in natural and artificial tree trunks (bort and koloda) and inhabiting
in the wild nature, maintain more effective than colonies in commercial
beehives on apiaries using the analysis of the level of introgression
of southern genes and assess the level of average heterozygosity
according based on polymorphism of 9 microsatellite loci. |
156. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Современное состояние
и сохранение темной лесной пчелы Apis mellifera mellifera в России и
странах Европы. Биомика. 2015. Т. 7. № 2. C. 121-127.
Ильясов
Р.А., Поскряков А.В., Николенко А.Г. Современное состояние и сохранение
темной лесной пчелы Apis mellifera mellifera в России и странах Европы.
Биомика. 2015. Т. 7. № 2. C. 121-127.
Ilyasov R.А., Poskryakov A.V., Nikolenko A.G. Current status and
preservation of the dark European bees Apis mellifera mellifera in
Russia and Europe. Biomics. 2015. V. 7 (2). P. 121-127.
В статье проведен анализ современного состояния популяции
темной
лесной пчелы A.m.mellifera в России и странах Европы. В странах Европы
еще сохранились небольшие резерваты на территории ряда стран. Россия на
данный момент располагает значительным резервом генофонда темной лесной
пчелы A.m.mellifera. Однако генофонд подвержен все усиливающейся
интрогрессии со стороны подвидов из южных регионов. В результате
скрещивания с южными подвидами происходит потеря адаптированности
темной лесной пчелы к местным условиям и снижение общей продуктивности.
Для сохранения генофонда темной лесной пчелы уже не достаточно видимых
морфометрических признаков, необходима селекция на основе анализа
молекулярных ДНК маркеров с охватом ядерного и митохондриального
генома. Поддержка со стороны Правительства и региональных обществ
пчеловодов в создании и становлении Российской ассоциации Apis
mellifera mellifera (РААММ) позволит объединить все усилия пчеловодов
России по сохранению аборигенной темной лесной пчелы и перевести
пчеловодство России на новый генетический уровень селекции.
The article analyzes the current status of the population of the dark
European bees A.m.mellifera in Russia and Europe. In Europe, still
remained small reserves in the territory of some countries. Now in
Russia has a large reserve of the gene pool of a dark European bees
A.m.mellifera. However, the gene pool is subject to increasing
introgression from the subspecies from the southern regions, which lead
dark European bees to the loss adaptation to local conditions and
reduce full productivity. To preserve the gene pool of the dark
European bees is not sufficiently only visible morphometric traits but
necessary selection based on the analysis of molecular DNA markers,
covering nuclear and mitochondrial genome. Supporting of Government and
the regional beekeepers associations in the creation and development of
the Russian Association of Apis mellifera mellifera (RAAMM) will
integrate all the efforts of Russian beekeepers to preserve native dark
European and help to transition of Russian beekeeping to a new level of
genetic selection. |
155. Ильясов Р.А., Поскряков А.В., Николенко А.Г. Современное состояние
и сохранение генофонда Apis mellifera mellifera в России и странах
Европы. Пчеловодство. 2016. № 1. С. 8-11.
Ильясов
Р.А., Поскряков А.В., Николенко А.Г. Современное состояние и сохранение
генофонда Apis mellifera mellifera в России и странах Европы.
Пчеловодство. 2016. № 1. С. 8-11.
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Current status and
preservation of gene pool of Apis mellifera mellifera in Russia and
Europe. Russian Journal of Beekeeping. 2016. V. 1. P. 8-11.
The article analyzes the current status of the population of the dark
European bees A.m.mellifera in Russia and Europe. In Europe, still
remained small reserves in the territory of some countries. Russia
still has a large reserve of the gene pool of a dark European bees
A.m.mellifera. However, the gene pool is subject to increasing
introgression from the subspecies from the southern regions, which lead
dark European bees to the loss adaptation to local conditions and
reduce full productivity. To preserve the gene pool of the dark
European bees is not sufficiently only visible morphometric traits but
necessary selections based on the analysis of molecular DNA markers,
covering nuclear and mitochondrial genome. Supporting of Government and
the regional beekeepers associations in the creation and development of
the Russian Association of Apis mellifera mellifera (RAAMM) will
integrate all the efforts of Russian beekeepers to preserve native dark
European and help to transition of Russian beekeepin to a new level of
genetic selection.
В статье проведен анализ современного состояния популяции темной лесной
пчелы A.m.mellifera в России и странах Европы. В странах Европы еще
сохранились небольшие резерваты на территории ряда стран. Россия еще
располагает значительным резервом генофонда темной лесной пчелы
A.m.mellifera. Однако генофонд подвержен все усиливающейся интрогрессии
со стороны подвидов из южных регионов, которая приводят к потере
адаптированности темной лесной пчелы к местным условиям и снижению
общей продуктивности. Для сохранения генофонда темной лесной пчелы уже
не достаточны видимых морфометрических признаков, необходима селекция
на основе анализа молекулярных ДНК маркеров с охватом ядерного и
митохондриального генома. Поддержка со стороны Правительства и
региональных обществ пчеловодов в создании и становлении Российской
ассоциации Apis mellifera mellifera (РААММ) позволит объединить все
усилия пчеловодов России по сохранению аборигенной темной лесной пчелы
и перевести пчеловодство России на новый генетический уровень селекции. |
154. Ильясов Р.А., Фархутдинов Р.Г., Иванов А.А., Шафикова В.М.,
Туктарова Ю.В., Воронков Ю.П. Состав для стимуляции развития пчелиных
семей, профилактики и лечения аскосфероза. Патент России № RU 2552672.
10.06.2015. Бюл. № 16.
Предлагаемое
изобретение относится к области зоотехнии. Предложенный состав содержит
водно-спиртовые экстракты травы вероники, листа березы, травы
лабазника, цветков календулы, хвои ели или пихты, травы эхинацеи,
листьев эвкалипта, травы хвоща, цветков бессмертника, травы мелиссы,
травы чабреца, коры осины, травы чистотела, слоевища исландского мха,
чеснока при определенном соотношении компонентов. Использование
изобретения повышает продуктивность и зимостойкость пчелиных семей за
счет повышения устойчивости организма пчел к аскосферозу и увеличивает
продолжительность действия препарата.
FIELD: agriculture. SUBSTANCE: composition comprises wateralcohol
extracts of speedwell grass, birch leaves, meadowsweet grass, marigold
flowers, fir or spruce needles, Echinacea grass, eucalyptus leaves,
horsetail grass, flowers of helichrysum, balm lemon grass, thyme grass,
bark of aspen, celandine grass, thallus of Iceland moss, garlic at a
certain ratio of the components. EFFECT: use of the invention improves
the productivity and winter hardiness of bee families by increasing the
bee body resistance to ascospherosis, and increases the duration of the
effect of the preparation.
Ильясов Р.А., Фархутдинов Р.Г., Иванов А.А., Шафикова В.М., Туктарова
Ю.В., Воронков Ю.П. Состав для стимуляции развития пчелиных семей,
профилактики и лечения аскосфероза. Патент России № RU
2552672. 10.06.2015.
Бюл. № 16.
Ilyasov R.A., Farkhutdinov R.G., Ivanov A.A., Shafikova V.M., Tuktarova
Yu.V., Voronkov Y.P. Composition for stimulation of development of bee
families, prevention and treatment of ascospherosis. Patent of Russia №
RU 2552672.
10.06.2015. Bull. № 16. |
153. Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Новая
классификация митотипов локуса COI-COII мтДНК пчел эволюционной ветви М
(Аpis mellifera mellifera, Аpis mellifera iberiensis).
Пчеловодство. 2015. № 9. С. 22-26.
В
статье проведен сравнительный анализ полиморфизма нуклеотидной
последовательности локуса COI- COII мтДНК представителей пчел
эволюционной ветви М уральской и зарубежных европейских популяций
темной лесной пчелы А. m. mellifera, а также иберийской пчелы А. m.
iberiensis. Нами предложена новая митотипическая классификация темной
лесной пчелы и иберийской пчелы эволюционной ветви М, основанная на
анализе 8 наиболее информативных SNP. Данная классификация позволит
оценить уровень митотипического разнообразия всей популяции темной
лесной и иберийской пчелы, сохранить и поддерживать уровень
митотипического разнообразия, выявить митотипы, представляющие
наибольшую ценность для селекции и разведения.
Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Новая
классификация митотипов локуса COI-COII мтДНК пчел эволюционной ветви М
(Аpis mellifera mellifera, Аpis mellifera iberiensis).
Пчеловодство. 2015. № 9. С. 22-26.
The article provides a comparative analysis of the nucleotide sequence
polymorphism of loci COI- COII mtDNA representatives bee evolutionary
lineage M of Ural and foreign European populations of dark European
bees A. m. mellifera, and the Iberian bees A. m. iberiensis. We have
proposed a new mitotypic classification of dark European bees and
Iberian bees of evolutionary lineage M, based on an analysis of eight
of the most informative SNP. This classification will allow to estimate
the level of mitotypic diversity of the whole population of dark
European and the Iberian bees, to preserve and maintain the level of
mitotypic diversity, to recognize most important mitotypes for the
selection and breeding.
Ilyasov RA., Poskryakov A.V., Petukhov A.V., Nikolenko A.G. New
mitotypic classification of mitochondrial COI-COII loci of honeybees of
evolutionary lineage M (Аpis mellifera mellifera, Аpis mellifera
iberiensis). Russian Journal of Beekeeping. 2015. V. 9. P. 22-26. |
152. Kaskinova M.D., Ilyasov R.A., Poskryakov A.V., Nikolenko A.G.
Analysis of the Genetic Structure of Honeybee (Apis mellifera L.)
Populations. Russian Journal of Genetics. 2015. V. 51 (10). P.
1033-1035. DOI: 10.1134/S1022795415100075.
Представлены
результаты анализа генетической структуры популяции медоносной пчелы в
южной части Башкортостана по данным мтДНК (локус COI-COII) и пяти
микросателлитным локусам ядерной ДНК (Ар243, 4А110, А8, А113 и А28).
Полученные данные свидетельствуют, что исследуемые популяции пчел
испытывают дефицит гетерозигот, несмотря на интенсивную межпородную
гибридизацию,
а также позволяют предположить локализацию в изучаемом регионе границы
между популяцией Apis mellifera mellifera L. и гибридной зоной.
The
genetic structure of honeybee populations from the southern part of
Bashkortostan was assessed based on an analysis of mtDNA
(COI–COII
locus) and five nuclear DNA microsatellite loci (Ap243, 4A110, A8,
A113, and A28). The data indicate that the examined populations
experience a deficit of heterozygotes despite intense interpedigree
hybridization. It is suggested that there is a boundary between the
population of Apis mellifera mellifera L. and the hybrid zone in the
examined region.
Kaskinova M.D., Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Analysis
of the Genetic Structure of Honeybee (Apis mellifera L.) Populations.
Russian Journal of Genetics. 2015. V. 51 (10). P. 1033-1035. (IF
0.446). DOI: 10.1134/S1022795415100075. |
151. Каскинова М.Д., Ильясов Р.А., Поскряков А.В., Николенко А.Г.
Анализ генетической структуры популяций медоносной пчелы (Apis
mellifera L.). Генетика. 2015. Т. 51. № 10. C. 1199-1202. (IF 0.446).
DOI: 10.7868/S0016675815100070.
Представлены
результаты анализа генетической структуры популяции медоносной пчелы в
южной части Башкортостана по данным мтДНК (локус COI-COII) и пяти
микросателлитным локусам ядерной ДНК (Ар243, 4А110, А8, А113 и А28).
Полученные данные свидетельствуют, что исследуемые популяции пчел
испытывают дефицит гетерозигот, несмотря на интенсивную межпородную
гибридизацию, а также позволяют предположить локализацию в изучаемом
регионе границы между популяцией Apis mellifera mellifera L. и
гибридной зоной.
The genetic structure of honeybee populations from the southern part of
Bashkortostan was assessed based on an analysis of mtDNA
(COI–COII locus) and five nuclear DNA microsatellite loci
(Ap243,
4A110, A8, A113, and A28). The data indicate that the examined
populations experience a deficit of heterozygotes despite intense
interpedigree hybridization. It is suggested that there is a boundary
between the population of Apis mellifera mellifera L. and the hybrid
zone in the examined region.
Каскинова М.Д., Ильясов Р.А., Поскряков А.В., Николенко А.Г. Анализ
генетической структуры популяций медоносной пчелы (Apis mellifera L.).
Генетика. 2015. Т. 51. № 10. C. 1199-1202. (IF 0.446). DOI:
10.7868/S0016675815100070.
Kaskinova M.D., Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Analysis
of the Genetic Structure of Honeybee (Apis mellifera L.) Populations.
Russian Journal of Genetics. 2015. V. 51. (10). P. 1199-1202. (IF
0.446). DOI:
10.7868/S0016675815100070. |
150. Ilyasov R. A., Kosarev M. N., Neal A. & Yumaguzhin F. G.
Burzyan Wild-Hive Honeybee A.m.mellifera in South Ural. Bee World.
2015. V. 92 (1). P. 7-11. (IF 0.62). DOI:
10.1080/0005772X.2015.1047634.
A
spontaneous hybridization among honeybees in most European countries
has led to the loss in the gene pool of the dark European honeybee. We
believe Russia still has a considerable array of purebred populations
of European dark bees, A.m. mellifera. The most common bee, the Burzyan
Honey Bee, lives under protection in the mountain forest zone of South
Ural in the State Nature Biosphere Reserve
“Shulgan-Tash”,
the regional nature reserve “Altyn Solok”, and the
National
Park “Bashkortostan”. These wild tree hollow
honeybees are
of great interest among beekeepers and scientists around the world, as
they could be used to help reconstruct the natural history of bees.
Ilyasov R. A., Kosarev M. N., Neal A. & Yumaguzhin F. G.
Burzyan
Wild-Hive Honeybee A.m.mellifera in South Ural. Bee World. 2015. V. 92
(1). P. 7-11. (IF 0.62). DOI: 10.1080/0005772X.2015.1047634. |
149. Ilyasov
R.A., Poskryakov A.V., Nikolenko A.G. Nucleotide
polymorphism of the gene VG of honey bees. Biomics. 2015. V. 7 (1). P.
54-61.
Conservation
of the gene pool of dark European bees A.m.mellifera is extremely
important for the successful development of beekeeping in the Northern
Eurasia. There are many established methods for
differentiating
honey bee subspecies. This study evaluated single nucleotide
polymorphisms (SNP) as a marker for genotyping of honey bees.
The
gene vitellogenin (Vg) is involved in the regulation of social
organization of honey bees. We sequenced Vg of dark European
bees
from Ural population and found 26 unique SNP for
A.m.mellifera in
its exons, which can be useful for genetic cataloging of
colonies.
Сохранение генофонда темной лесной пчелы A.m.mellifera чрезвычайно
важно для успешного развития пчеловодства Северной Евразии. Существуют
множество методов дифференциации подвидов медоносной пчелы. Наше
исследование основано на оценке однонуклеотидного полиморфизма (SNP) и
использования его в качестве маркера для генотипирования медоносных
пчел. Ген вителлогенина (Vg) участвует в регуляции общественной
организации в семье медоносной пчелы. Мы просеквенировали шесть экзонов
гена Vg темных лесных пчел уральской популяции и нашли уникальные для
A.m.mellifera 26 SNP, которые могут быть полезны для
генетической
паспортизации семей.
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Nucleotide polymorphism
of the gene VG of honey bees. Biomics. 2015. V. 7 (1). P. 54-61. |
148.
Ильясов Р.А., Косарев М.Н., Юмагужин Ф.Г. Бурзянская бортевая пчела и
бортевое пчеловодство на Южном Урале. Пчеловодство. 2015. № 7. С. 12-15.
Бурзянская бортевая пчела и бортевое пчеловодство на
Южном Урале (Burzyan wild-hive honeybee and wild-hive beekeeping in
South Ural)
A spontaneous hybridization among honeybees in most European countries
has led to the loss in the gene pool of the dark European honeybee. We
believe Russia still has a considerable array of purebred populations
of European dark bees A. m. mellifera. The commonest bee, the Burzyan
Honey Bee, live under protection in the mountain forest zone of South
Ural in the State Nature Biosphere Reserve
«Shulgan-Tash»,
regional nature reserve «Altyn Solok» and National
Park
«Bashkortostan». These Wild Tree Hollow Honeybees
are of
great interest among beekeepers and scientists around the world, as
they could be used to make a reconstruction of the natural history of
bees.
На современном этапе развития пчеловодства в Евразии, на фоне массовой
гибридизации подвидов пчел и потери генофонда темной лесной
(среднеевропейской) пчелы в большинстве стран Европы, Россия
располагает значительными массивами чистопородных популяций темной
лесной пчелы A. m. mellifera. Наиболее известная популяция –
бурзянская бортевая пчела – сохраняется в условиях бортевого
пчеловодства, дикого обитания и пасек с рамочными ульями в горно-лесной
зоне Южного Урала на территории государственного природного биосферного
заповедника «Шульган-Таш», регионального природного
заказника «Алтын Солок» и национального парка
«Башкирия». Дикие и бортевые пчелы представляют
большой
интерес для пчеловодов и ученых всего мира, так как по ним можно
сделать реконструкцию естественной истории пчел.
Ilyasov R.A., Kosarev M.N., Neal A., Yumaguzhin F.G. Burzyan wild-hive
honeybee and wild-hive beekeeping in South Ural. Russian journal of
beekeeping. 2015. V. 7. P. 12-15.
Ильясов Р.А., Косарев М.Н., Юмагужин Ф.Г. Бурзянская бортевая пчела и
бортевое пчеловодство на Южном Урале. Пчеловодство. 2015. № 7. С. 12-15.
Publication Name: Ilyasov R.A., Kosarev M.N., Yumaguzhin F.G. Burzyan
wild-hive honeybee and wild-hive beekeeping in South Ural. Russian
journal of beekeeping. 2015. V. 7. P. 12-15.
|
147.
Ilyasov R.A., Poskryakov A.V., Petukhov A.V., Nikolenko A.G. Genetic
Differentiation of Local Populations of the Dark European Bee Apis
mellifera mellifera L. in the Urals. Russian journal of genetics. 2015.
V. 51 (7). P. 677–682.
Genetic
Differentiation of Local Populations of the Dark European Bee Apis
mellifera mellifera L. in the Urals
For the last two centuries, beekeepers in Russia and Europe have been
introducing bees from the southern regions to the northern ones,
subjecting the genetic pool of the dark European bee Apis mellifera
mellifera L. subspecies to extensive hybridization. In order to
reconfirm on the genetic level the previously published morphological
data on the native bee population in the Urals, the Bashkortostan
Republic, and the Perm Krai, we analyzed the polymorphism of the
mitochondrial (mtDNA COI–COII intergenic locus) and nuclear
(two
microsatellite loci, ap243 and 4a110) DNA markers. Four local
populations of the dark European bee A. m. mellifera surviving in the
Urals have been identified, and their principal genetic characteristics
have been determined. Data on the genetic structure and geographical
localization of the areals of the dark European bee local populations
in the Urals may be of use in restoring the damaged genetic pool of A.
m. mellifera in Russia and other northern countries.
Publication Name: Ilyasov R.A., Poskryakov A.V., Petukhov A.V.,
Nikolenko A.G. Genetic Differentiation of Local Populations of the Dark
European Bee Apis mellifera mellifera L. in the Urals. Russian journal
of genetics. 2015. V. 51 (7). P. 677–682. DOI:
10.1134/S1022795415070042 |
146. Шайнурова
А.А., Ильясов Р.А., Поскряков А.В., Николенко А.Г.
Сохранение генофонда популяции медоносной пчелы на территории
Баймакского района Республики Башкортостан. Материалы II Международной
научно-практической конференции «Биотехнологические аспекты
развития современного пчеловодства». Киров. 3-4 мая 2015. С.
183-184.
Медоносная
пчела подвида Apis mellifera mellifera L. является аборигенной для
республики Башкортостан. Для сохранения башкирской популяции этого
подвида необходима разметка границ ее ареала (Николенко, Поскряков,
2002). Apis mellifera mellifera отличается зимостойкостью,
устойчивостью к европейскому гнильцу, нозематозу и падевому токсикозу,
а также высокой медопродуктивностью при коротком медосборе (например, с
липы). У них сухая печатка мёда, что особенно ценно при зимовке в
сложных условиях и при производстве высококачественного сотового меда.
Именно эти уникальные признаки позволили разводить и содержать
значительное количество пчелиных семей в суровом климате Южного Урала
(Кожевников, 1929). Цель эксперимента заключалась в геногеографическом
анализе популяции с целью определения сохранности генофонда башкирской
пчелы в Баймакском районе.
Для исследования
были отобраны пчелы с 13 пасек Баймакского района.
Мы исследовали на
основе
ПЦР-анализа полиморфизм межгенного локуса COI-COII митохондриальной
ДНК. Аллель PQQ — маркер происхождения семьи башкирской
породы A.
m. mellifera по материнской линии. В дальнейшем нами были рассчитаны
частоты встречаемости PQQ и Q.
Таким образом,
нами было
обнаружено восемь чистопородных пасек на территории Баймакского района.
Остальные пять пасек оказались гибридными. Генофонд пчел баймакской
популяции на большей части занимаемой территории характеризуется
чистопородным происхождением аборигенной башкирской породы A. m.
mellifera.
Honeybee subspecies Apis mellifera mellifera L. is a native of the
Republic of Bashkortostan. To preserve the Bashkir population of this
subspecies requires marking the boundaries of its range (Nikolenko,
Poskryakov, 2002). Apis mellifera mellifera different hardiness,
resistance to European foulbrood, nosema and honeydew toxicity, as well
as high Medoproduktivnost short-honey collection (for example, linden).
They dry signet honey, which is especially valuable for wintering in
difficult conditions and the production of high-quality honeycomb. It
is these unique features have allowed to breed and maintain a
significant number of bee colonies in the harsh climate of the Southern
Urals (Kozhevnikov, 1929). The purpose of the experiment was to
analysis and gene geographic populations in order to determine the
safety of the gene pool of the Bashkir bee in Baimak area.
For the study were selected from 13 apiaries bee Baimak area.
We investigated on the basis of PCR polymorphism intergenic locus
COI-COII mitochondrial DNA. Allele PQQ - marker family of origin of the
Bashkir breed A. m. mellifera through the maternal line. In the future,
we calculated the incidence of PQQ and Q.
Thus, we found eight purebred Baimak apiaries in the territory of the
district. The other five proved to be hybrid apiaries. The gene pool of
bees Baimak population in most of the occupied territory is
characterized purebred origin of the Bashkir breed indigenous A. m.
mellifera. |
145.
Ilyasov R.A., Kosarev M.N., Neal A., Yumaguzhin F.G. Burzyan wild-hive
honeybee A. m. mellifera in South Ural. The Beekeepers Quarterly. 2015.
V. 119. P. 25-33.
Burzyan wild-hive honeybee A.
m. mellifera in South Ural. A spontaneous hybridization
among honeybees in
most European countries has led to the loss in the gene pool of the
dark
European honeybee. We
believe Russia still has a considerable array of pure bred populations
of
European dark bees
A. m. mellifera. The commonest bee, the Burzyan Honeybee, lives under
protection in the
mountain forest zone of South Ural in the State Nature Biosphere
Reserve 'Shulgan- Tash',
regional nature reserve Altyn Solok' and National Park
«Bashkortostan». These Wild Tree Hollow Honeybees
are
of great interest
among beekeepers and scientists around the world, as they could
be used to make
a reconstruction of the natural history of bees.
Publication Name:
Ilyasov R.A., Kosarev M.N., Neal A., Yumaguzhin F.G. Burzyan wild-hive
honeybee A. m. mellifera in South Ural. The Beekeepers Quarterly. 2015.
V. 119. P. 25-33. |
144.
Ильясов Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Генетическая
дифференциация локальных популяций темной лесной пчелы Apis mellifera
mellifera L. на Урале. Генетика. 2015. Т. 51. № 7. С. 792–798.
Генетическая
дифференциация локальных популяций темной лесной пчелы Apis mellifera
mellifera L. на Урале (Genetic differenciation of local population of
dark European bees Apis mellifera mellifera L. in Ural).
During the last
two
centuries, beekeepers in Russia and European countries imported bees
from southern regions to the north, resulting in the gene pool of a
dark forest bee subspecies Apis mellifera mellifera L. was subject to
significant hybridization. To clarify the genetic level previously
published in the literature on the morphological data native bee
populations in the Urals, in the Republic of Bashkortostan and the Perm
region we have analyzed markers of mitochondrial polymorphism
(intergenic locus COI-COII mtDNA) and nuclear (two microsatellite loci,
ap243 and 4a110) DNA . Select the four surviving local populations dark
forest bees A. m. mellifera in the Urals and received their basic
genetic characteristics. Data on the genetic structure and geographical
location of areas of local populations dark forest bees in the Urals
can be helpful in restoring the disturbed gene pool of A. m. mellifera
in Russia and other northern countries.
В течение
последних двух
веков пчеловоды в России и европейских странах завозили пчел из южных
регионов в северные, в результате чего генофонд темной лесной пчелы
подвида Apis mellifera mellifera L. был подвержен значительной
гибридизации. Для уточнения на генетическом уровне ранее опубликованных
в литературе морфологических данных по аборигенной популяции пчел на
Урале, в Республике Башкортостан и Пермском крае нами проведен анализ
полиморфизма маркеров митохондриальной (межгенный локус COI-COII мтДНК)
и ядерной (два микросателлитных локуса, ap243 и 4a110) ДНК. Выделены
четыре сохранившиеся локальные популяции темной лесной пчелы A. m.
mellifera на Урале и получены их основные генетические характеристики.
Данные о генетической структуре и географической локализации ареалов
локальных популяций темной лесной пчелы на Урале могут быть полезны при
восстановлении нарушенного генофонда A. m. mellifera в России и других
северных странах.
Publication Name:
Ilyasov R.A., Poskryakov A.V., Petukhov A.V., Nikolenko A.G. Genetic
differenciation of local population of dark European bees Apis
mellifera mellifera L. in Ural. Russian journal of genetics, 2015. V.
51 (7). P. 792–798. DOI:10.7868/S0016675815070048 |
143.
Ilyasov R.A., Kosarev M.N., Neal A., Yumaguzhin F.G. Burzyan bees in
South Ural. Bees for Development Journal. V. 114. 2015. P. 11-17.
Burzyan
bees in South Ural
The hybridisation
within
honey bees in most European countries has led to loss of the European
honey bee Apis mellifera mellifera gene pool. We believe that Russia
still has pure populations of these European black bees. The most
common honey bee, the Burzyan bee, is protected in the mountain forest
zone of South Ural in the Shulgan-Tash State Nature Biosphere Reserve,
the Altyn Solok Regional Nature Reserve and the Bashkortostan National
Park. These bees nesting in hollow trees are of great interest for
understanding the natural history of honey bees.
Ilyasov R.A.,
Kosarev
M.N., Neal A., Yumaguzhin F.G. Burzyan bees in South Ural. Bees for
Development Journal. V. 114. 2015. P. 11-17.
Publication Name:
Ilyasov R.A., Kosarev M.N., Neal A., Yumaguzhin F.G. Burzyan bees in
South Ural. Bees for Development Journal. V. 114. 2015. P. 11-17. |
142.
Ilyasov
R.A., Kosarev M.N., Neal A., Yumaguzhin F.G. Wild dark honey bees of
the Urals. The Four Seasons. 2015. V. 55. P. 27-33.
Wild
dark honey bees of the Urals. A SPONTANEOUS hybridisation among honey
bees in most European countries has led to the loss in the gene pool of
the dark European honey bee (Apis mellifera mellifera). We believe
Russia still has a considerable array of purebred populations of
European dark bees. The most common bee, the Burzyan honey bee, lives
under protection in the mountain forest zone of South Ural in the
Shulgan-Tash State Nature Biosphere Reserve, the Altyn Solok Regional
Nature Reserve and the Bashkortostan National Park. These wild
tree-hollow honey bees are of great interest among beekeepers and
scientists around the world, as they could be used to reconstruct the
natural history of bees. The European dark bee is a unique subspecies
of A. mellifera evolutionarily adapted to live in the continental
climate of northern Eurasia, which has long cold winters. Today, this
subspecies mostly survives only in a few isolated reservation areas.
The biggest areas are in Russia, with about 300,000 colonies having
avoided spontaneous hybridisation in the South Ural area of the
Republic of Bashkirostan, about 200,000 colonies in the Middle Ural
area and about 250,000 colonies in the Volga region of the Republic of
Tatarstan. We also have information about large populations of European
dark bee in the Altai region of the Republic of Udmurtia. About 99% of
European dark bees in the South Ural are kept in framed hives in
apiaries (Figure 1) and about 1% in both natural and specially made
tree hollows. The evolution of the dark bee was synchronous with the
evolution of the widely spreading linden tree Tilia cordata and
therefore the main forage crop for these bees is when these trees
blossom. Scientists at the Biochemical Insects Adaptation Laboratory in
the Ufa Scienti c Centre of the Russian Academy of Science have been
monitoring the gene pool of the Burzyan honeybees for the past 20 years
using polymorphism of loci COI-COII of mtDNA and microsatellite loci
ap243 and 4a110 of nuclear DNA. This extensive research con rmed the
pureness of the gene pool and that this gene pool is of the A. m.
mellifera subspecies. In 2011, upon request by the Institute of
Beekeeping and the Shulgan-Tash State Reserve, bees from this
population were classi ed as a separate breed type: the Burzyan
wild-hive honey bee (Figure 2). This breed was registered patent No.
5956 from 14.06.2011 by the State Commission of the Russian Federation
in the state register. According to artefacts found at a burial site of
the Bahmutin culture near Birsk, beekeeping in the southern Ural
started no later than 500-600BC among local Finno-Ugric tribes. Later
beekeeping was adopted by ancestors of the Bashkir people, which
assimilated and drove away the Bahmutin. Beekeeping did not require
tools of iron, and the skills accumulated were passed on by many
generations of tree-hollow beekeepers (Figure 3). Bashkir
beekeeping ourished in the 18th century. It took it longer to
develop than in Germany, Poland, Lithuania, Belarus and central regions
of Russia, but the Bashkir beekeepers had a more perfect, convenient
and reliable set of tools and accessories. With special land tenure
rights, the Bashkirs could avoid compliance with the requirements of
the Forest Service in Russia, which in 1882 had banned beekeeping in
state forests as a source of forest res. In the 19th century
due
to deforestation and the destruction of their cultural traditions by
the migrant population, Bashkir beekeepers developed
‘Koloda’ beekeeping, which involves the use of
handmade
hollows inside tree trunks (Figure 4) that could be xed high
on a
tree. Trees with ‘Koloda’ were considered by
Bashkirs as
personal property and were marked with ‘Tamga’,
distinctive
signs of tribal a liation (Figures 5 and 6). Every beekeeper knew his
mark and did not touch the property of others, and these trees with
‘Koloda’ and ‘Tamga’ were
traditionally kept by
a family for generations. In the second half of the 20th century,
Bashkir beekeepers started using movable-frame hives, which gave rise
to modern beekeeping. Despite the hard labour and low productivity,
tree hollow apiculture in remote areas of the South Urals still
continues. Inspections of hollow-tree hive bees require working at
heights of up to 16 meters, and because they are located away from
populated areas, the beekeeper has to travel on horseback a distance of
40-50km per day (Figures 7 and 8). Tools used by Bashkir beekeepers are
mostly homemade but are similar to tools used in other countries. Tools
unique to the Bashkir wild-hive beekeepers are the
‘Kiram’,
a braided leather belt up to 5m in length for climbing a tree, and the
‘Lange’, a small portable platform or footrest
(Figure 9),
which is xed on the trunk with a rope. In the last centuries,
when there were enough natural tree hollows containing bees, Bashkirs,
like beekeepers around the world, in the autumn took all the honey from
the colony and the bees, left without reserves, died. In spring,
beekeepers checked these tree hollows, cleaned them and made them ready
for a new occupation by a swarm. This system of killing colonies to
remove the honey was used until the 19th century and in some areas
until the 1950s. The advantage of this system was that a new comb was
created every year, tree hollows rot less and, as a result, bees were
rarely sick, their body size did not decrease due to using old comb,
and there was less chance of inbreeding and degeneration. However, when
the number of natural tree hollows declined sharply, beekeepers were
forced to carefully treat the wild-hive bees and leave the best of them
with su cient honey for the winter. As a result, colonies were able to
live a long time in the same place (up to 18-25 years!) and beekeepers
had to learn how to replace a comb but the life of the hollows was
reduced. Figure 10 shows an interior view of an arti cial hollowtree
hive. Wild-hive bees in the Ural area also have many natural enemies
that weaken the colony and cause their death. These are the brown bear
(Ursus arctos), the pine marten (Martes martes), the forest mouse
(Apodemus uralensis), the great spotted woodpecker (Dendrocopos major),
the European beeeater (Merops apiaster), the large wax moth (Galleria
mellonella), the European hornet (Vespa crabro), the red wood ant
(Formica rufa), and the red wasp (Dolichovespula rufa). They also have
not escaped modern honey bee diseases and parasites, such as the varroa
mite, Nosema apis, chalkbrood disease, and American and European
foulbrood. However, these diseases are more severe in modern,
movable-frame hives than in treehollow hives. The population of
tree-hollow bees has cyclical swings that depends on solar activity.
Currently, dark European bees exist in the southern Urals in the
Shulgan-Tash State Reserve, where they live in natural and handmade
tree hollows. The reserve was established in 1958 and it covers an area
of about 54,000 acres. The bees also live in the Altyn Solok regional
nature reserve, established in 1997 with an area of 222,000 acres, and
the Bashkiria national park, established in 1986 with an area of
203,000. At the end of 2014, these three national parks had about 1,200
trees with handmade tree hollow hives but only 300 of these had bees.
About 4,000 colonies are kept in apiaries with modern movable-frame
hives, and 200-400 colonies live in natural tree hollows. In 2012,
these reserves were listed as specially protected areas, together with
a number of others, and acquired the status of a
‘biosphere’ by UNESCO called the Bashkir Ural
complex, with
a total area of 855,000 acres. The Altyn Solok regional reserve is also
protected by the Ministry of Environment of the Republic of
Bashkortostan. Currently, in order to preserve the Burzyan honey bee,
it is planned to expand the Shulgan-Tash reserve in a north-west
direction through undeveloped territory between the rivers Nugush and
Uruk. The sta from Shulgan-Tash, Altyn Solok and Bashkiria,
together with local beekeepers, are constantly taking measures to
increase the bee population and carry on selection work to improve
immunity, winter hardiness and productivity of the Burzyan bees. This
policy of state protected reservations allows us to save a unique
population of these A. m. mellifera bees in Eurasia in the face of new
threats of spontaneous hybridization and habitat destruction.
Author a¬liations and Contacts RA Ilyasov1, Ufa Scienti c
Centre of
the Russian Academy of Science, Institute of Biochemistry and Genetics
450054, Russia, Ufa, prospect Oktyabrya, 71, Email:
apismell@hotmail.com MN osarev, Shulgan-Tash State Nature
Reserve, Email: mnkos@mail.ru A Neal, UK beekeeper, Woking, Email:
Alla. Neal@allaccounting.co.uk FG Yumaguzhin, Bashkir State Agrarian |
141.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Роль однонуклеотидных
замен в гене вителлогенина при идентификации темной лесной пчелы.
Пчеловодство. 2015. № 3. С. 22-24.
Роль
однонуклеотидных замен в гене вителлогенина при идентификации темной
лесной пчелы (Role of single nucleotide polymorphism of the gene
vitellogenin for dark forest bees identification)
Comparative
analysis of
nucleotide sequences of the gene Vg showed significant genetic
variability in different subspecies of honey bees Apis mellifera. We
found 24 single nucleotide polymorphism (SNP) wich can be used for
genetic identification of bees from M lineage (Apis mellifera
mellifera) and С lineage (A. m. caucasica, A. m. carnica, A. m.
carpatica, A. m. ligustica).
Сравнительный
анализ
нуклеотидной последовательности гена Vg показал значительную
генетическую изменчивость у представителей разных подвидов медоносной
пчелы Apis mellifera. Обнаруженные нами 24 однонуклеотидные замены
(SNP) могут быть использованы в качестве ядерных SNP-маркеров для
генетической дифференциации представителей пчел эволюционных ветвей М
(Apis mellifera mellifera) и С (A. m. caucasica, A. m. carnica, A. m.
carpatica, A. m. ligustica).
Ilyasov R.A.,
Poskryakov
A.V., Nikolenko A.G. Role of single nucleotide polymorphism of the gene
vitellogenin for dark forest bees identification. Russian journal of
beekeeping. 2015. V. 3. P. 22-24.
Publication Name:
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Role of single nucleotide
polymorphism of the gene vitellogenin for dark forest bees
identification. Russian journal of beekeeping. 2015. V. 3. P. 22-24. |
140.
Брандорф А.З., Ильясов Р. А., Неал А. Пчеловодство Великобритании.
Пчеловодство.2015. №1. С.64-66.
Пчеловодство Великобритании
(The Beekeeping of the Great Britain)
This paper says
about
the beekeeping international 50 year anniversary conference of BIBBA
and SICAMM which was in Langollen (North Wales) at the
september-october of 2014. We tell about most speakers and about
features of British beekeeping. The conference was great experience for
all participants. At this conference in first time was participated
Russian scientists.
В статье кратко
рассказано о пчеловодстве Великобритании. На основе материалов 13-й
Конференции SICAMM показано значение темной пчелы (Apis mellifera
mellifera) в равитии пчеловодства стран Европейского союза.
Brandorf A.Z.,
Ilyasov R.A., Neal A. The Beekeeping of the Great Britain. Russian
journal of beekeeping. 2015. V.1. P. 64-66.
Publication Name:
Brandorf A.Z., Ilyasov R.A., Neal A. The Beekeeping of the Great
Britain. Russian journal of beekeeping. 2015. V.1. P. 64-66. |
139.
Ильясов Р.А., Прощалыкин М.Ю., Поскряков А.В., Лелей А.С., Николенко
А.Г. Популяция Apis cerana на Дальнем Востоке России. Биомика, 2014. Т.
3, № 2. С. 139-144.
Популяция Apis cerana на
Дальнем Востоке России (Apis cerana population in the Far East of
Russia)
Китайская
восковая пчела
Apis cerana распространена преимущественно в Азии. В последнее время
наблюдается резкое сокращение ареала и катастрофическое снижение
численности дальневосточной популяции китайской восковой пчелы в
уссурийской тайге в результате пожаров, вырубок широколиственных лесов
и обработок леса от насекомых-вредителей. В Хасанском районе
Приморского края в заказнике «Барсовый» и
заповеднике
«Кедровая падь» сохранилась небольшая популяция
A.cerana.
На основе секвенционного анализа локуса COI мтДНК мы обнаружили 4
генетические группы в дальневосточной популяции восковой пчелы
A.cerana. Наибольшее генетическое сходство с другими азиатскими
популяциями A.cerana наблюдалось у представителей пчел из
Академгородка, заповедника Кедровая Падь, п. Ромашка. Наибольшее
генетическое разнообразие наблюдалось в популяции пчел п. Ромашка. Для
сохранения полноценной популяции восковой пчелы в России необходимо
сохранить представителей всех четырех генетических групп для сохранения
максимального уровня их генетического разнообразия.
Apis cerana
distributed
mainly in Asia. Recently there has been a sharp reduction in the range
and the catastrophic decline of the population of the Far Eastern Apis
cerana in the Ussuri taiga in fires, cuttings of deciduous forests and
forest treatments from insect pests. In Khasan district of Primorye
Territory in reserve "Barsovy" and reserve "Cedar Pad" remained a small
population A.cerana. On the basis of analysis sekventsionnogo locus COI
mtDNA, we found four genetic groups in the population of the Far
Eastern bees wax A.cerana. The highest genetic similarity with other
Asian populations A.cerana observed in bees representatives of
Akademgorodok, Cedar Pad reserve, p. Chamomile. The greatest genetic
diversity was observed in the population of bees p. Chamomile. To
preserve the full population of bees wax in Russia is necessary to keep
all four genetic groups to preserve their maximum level of genetic
diversity.
Publication Name:
Ilyasov R.A., Proshhalykin M.Yu., Poskryakov A.V., Leley A.S.,
Nikolenko A.G. Apis cerana population in the Far East of Russia.
Biomics. 2014. V.3 (2). P. 139-144. |
138.Ильясов
Р.А., Гайфуллина Л.Р., Салтыкова Е.С., Николенко А.Г. Биология,
распространение и профилактика микроспоридий рода Nosema,
паразитирующих на медоносной пчеле. Биомика, 2014. Т. 3, № 2. С.
145-154.
Биология,
распространение и профилактика микроспоридий рода Nosema,
паразитирующих на медоносной пчеле (Biology, distribution, and
prevention of microsporidia species of Nosema, parasited on honey bee)
В популяции пчел
A.
mellifera и A. cerana широко рапространены классический нозематоз типа
А и азиатский нозематоз типа С - очень опасные микроспоридиозы, ведущие
к потере продуктивности пчелиных семей и их гибели. Оба вида нозематоза
имеют неравномерное распределение в ареале медоносной пчелы: разные
регионы различаются как видовым составом, так и количественным
содержанием микроспоридий. В распространении нозематоза большое
значение имеет таксономическая принадлежность пчел - разные подвиды
пчел имеют разную устойчивость к этому заболеванию: пчела подвида
A.m.mellifera L., в отличие от пчел других подвидов наименее подвержена
заражению нозематозом. В связи с тем, что вид N. ceranae, в сравнении с
N.apis, характеризуется значительной устойчивостью к антибиотикам и
фунгицидам, высокими уровнями вирулентности и темпа размножения,
непредсказуемыми сроками манифестации нозематоза и широкой
представленностью в тканях и органах организма медоносной пчелы,
необходимо разрабатывать индивидуальные для каждого вида
модифицированные методы профилактики и лечения.
In a population
of bees
A. mellifera and A. cerana widely raprostraneny nosema classic type A
and type C nosema Asian - a very dangerous Microsporidiosis, leading to
loss of productivity of bee colonies and their death. Both species have
nosema uneven distribution in the area of the honeybee: different
regions differ both in species composition and quantitative content of
microsporidia. In distributing nosema is very important taxonomic
affiliation of bees - different subspecies of bees have different
resistance to the disease: bee subspecies Ammellifera L., unlike bees
other subspecies of the least likely to be infected nosema. Due to the
fact that the form of N. ceranae, compared with N.apis, characterized
by considerable resistance to antibiotics and fungicides, high levels
of virulence and reproductive rate, unpredictable timing manifestation
nosema and broad representation in the tissues and organs of the body
of the honeybee, it is necessary to develop customized for each type of
modified methods of prevention and treatment.
Publication Name:
Ilyasov R.A., Gayfullina L.R., Saltykova E.S., Nikolenko A.G. Biology,
distribution, and prevention of microsporidia species of Nosema,
parasited on honey bee. Biomics V. 3 (2). 2014. 145-154. |
137.Ильясов
Р.А., Поскряков А.В., Петухов А.В., Николенко А.Г. Генетические
особенности островков популяции темной лесной пчелы на Урале.
Пчеловодство. 2015. № 2. С. 20-22.
Генетические
особенности островков популяции темной лесной пчелы на Урале (Genetic
features of island population of dark bees in Ural)
Современный ареал
темной
лесной пчелы Аpis mellifera mellifera L. значительно сократился в
результате антропогенной деятельности и ухудшения экологических
условий. Мы провели анализ полиморфизма маркеров митохондриальной
(межгенный локус COI-COII мтДНК) и ядерной (два микросателлитных локуса
ap243 и 4a110) ДНК с целью обнаружить сохранившиеся остатки генофонда
темной лесной пчелы. В ходе проведенных исследований были обнаружены
четыре островка сохранившейся популяции темной лесной пчелы A. m.
mellifera на Урале и получены их основные генетические характеристики.
Данные о генетической структуре и географической локализации островков
сохранившейся популяции темной лесной пчелы на Урале могут быть
использованы для восстановления в границах естественного ареала
генофонда A. m. mellifera, нарушенного в результате гибридизации, в
России и других странах Северной и Западной Европы.
The present area
of the
dark forest bee Apis mellifera mellifera L. significantly reduced as a
result of human activities and environmental degradation. We have
analyzed the polymorphism of mitochondrial markers (intergenic locus
COI-COII mtDNA) and nuclear (two microsatellite loci ap243 and 4a110)
DNA in order to detect the preserved remains of the gene pool of a dark
forest bees. In the course of studies have found four remaining
population of the island dark forest bees A. m. mellifera in the Urals
and obtained their basic genetic characteristics. Data on the genetic
structure and geographical location of islets surviving population of
the dark forest bees in the Urals can be used to restore the natural
habitat within the boundaries of the gene pool of A. m. mellifera,
disturbed as a result of hybridization in Russia and other countries of
Northern and Western Europe.
Publication Name:
Ilyasov R.A., Poskryakov A.V., Petukhov A.V., Nikolenko A.G. Genetic
features of island population of dark bees in Ural. Russian journal of
beekeeping. 2015. V. 2. P. 20-22. |
136.
Ильясов
Р.А. Изоляты темной лесной пчелы Apis mellifera mellifera L. на Южном и
Среднем Урале. Материалы Всероссийской научно-практической конференции
с международным участием, посвященной 100-летию со дня рождения
заслуженного деятеля науки РСФСР и Башкирской АССР, доктора
биологических наук, профессора П.Т. Тихонова. 18 ноября 2014 г. Уфа:
Башкирский ГАУ, 2014. С. 170-172.
Темная
европейская пчела A.m.mellifera является подвидом пчел, который
экономически выгодно разводить на северных территориях Евразии. К
сожалению, генофонд южных подвидов пчел в России постепенно вытесня- ет
аборигенный генофонд темной лесной пчелы. На данный момент сохрани-
лось очень мало резерватов темной лесной пчелы в Северной и Западной
Евратемных европейских пчел (около 500 000 семей) преимущественно в
двух регио- нах – Республике Башкортостан (около 300 000
семей) и
Пермском крае (около 200 000 семей). Часть этих пчел обитает в бортях в
лесу. На Урале были об- наружены около 10 популяций темной европейской
пчелы географически изоли- рованных от других популяций горно-лесными
массивами и расстояниями. Та- ким образом, популяции A.m.mellifera на
Урале могут являться резервами для восстановления генофонда темно
лесной пчелы на Северных территориях Евразии. Summary. Dark European
honey bees A.m. mellifera is subspecies of bees which economically
favourably for beekeepers to breeding in northern territories of
Eurasia. Unfortunately native gene pool of a dark European honey bees
gradually forced out by gene pool of southern subspecies of bees in
Russia. At present remained very few reserves of dark European honey
bees in Northern and Western Eurasia. In Russia in Urals is had huge
pool of dark European honey bees (about 500 000 colonies) mainly in two
regions – Bashkortostan republic (about 300 000 colonies) and
Permskii
Krai (about 200 000 colonies). The part of these bees is cave nesting
in hollows of a trees. We found about 10 isolated populations of dark
European honey bees in Urals. Thus Urals populations of dark European
honey bees A.m.mellifera can be source for restoration of a gene pool
of these bees in Northern territories of Eurasia. Ключевые слова:
медоносная пчела, Apis mellifera mellifera, локус COI-COII,
микросателлиты, популяционная генетика. Keywords: honey bee, Apis
mellifera mellifera, locus COI-COII, microsatellites, population
genetics. |
135.
Ilyasov
R.A., Farkhutdinov R.G., Shareeva Z.V. Influence of acaricides amitraz
and fluvalinate on average daily egg and total honey productivity of
honey bee colonies. Biomics. 2014, V. 6 (2). P. 73-76.
INFLUENCE OF ACARICIDES AMITRAZ
AND FLUVALINATE ON AVERAGE DAILY EGG AND TOTAL HONEY PRODUCTIVITY OF
HONEY BEE COLONIES
Varroa destructor
Anderson & Trueman is widespread parasitic mite in honey bee
population which causes varroosis. In Russia varroosis lead to mass
losses of honey bee Apis mellifera L. colonies and their honey
productivity. We have shown in our research negative impact of
acaricides amitraz and fluvalinate on total honey and average daily egg
productivity of honey bee colonies. We recommend in beekeeping no using
against Varroa chemical acaricides and try treatment bees by
alternative flours and extracts of medicinal plants in the season of
honey collecting in summer. For most economically effectiveness of
honey bee colonies treatment against Varroa by amitraz and fluvalinate
can only in spring before honey collecting and in autumn after honey
collecting seasons.
Publication Name:
Ilyasov R.A., Farkhutdinov R.G., Shareeva Z.V. Influence of acaricides
amitraz and fluvalinate on average daily egg and total honey
productivity of honey bee colonies. Biomics. 2014, V. 6 (2). P. 73-76. |
134.
Фархутдинов
Р.Г., Ильясов Р.А., Юмагужин Ф.Г., Туктарова Ю.В., Шафикова В.М.,
Абдуллин М.Ф. Биологический стимулятор продуктивности пчелиной семьи с
фунгицидной активностью. Биомика, 2014. Т. 6, № 2. С. 68-72.
БИОЛОГИЧЕСКИЙ
СТИМУЛЯТОР ПРОДУКТИВНОСТИ ПЧЕЛИНОЙ СЕМЬИ С ФУНГИЦИДНОЙ АКТИВНОСТЬЮ
(Biological stimulator for honey bee colony productivity with
fungicidal activity)
Аскосфероз
–
инфекционная болезнь пчелиной семьи, вызываемая паразитическим грибком
Ascosphaera apis. Аскосфероз подавляет развитие пчелиной семьи и может
привести к гибели при отсутствии лечения и стимуляции иммунитета.
Химические препараты с фунгицидным действием очень эффективны в борьбе
с аскосферозом, но обладают побочными действиями. В данной статье мы
описали препарат, представляющий собой спиртовый экстракт растительного
сбора, обладающий одновременно фунгицидным и стимулирующим эффектом для
пчелиной семьи. Применение этого препарата может повысить
продуктивность пчелиной семьи и снизить затраты на ее содержание.
Askosphaerosis -
infectious disease of bees caused by a parasitic fungus Ascosphaera
apis. Askosphaerosis suppresses the development of bee colonies and can
lead to death if untreated and stimulation of immunity. Chemicals with
fungicidal action are very effective in combating askosferozom, but
they have side effects. In this article we describe the drug, which is
a collection of alcoholic extract of plant that has both fungicidal and
stimulating effect for the bee colony. Its use can increase the
productivity of the bee families and reduce the cost of its maintenance.
Publication Name:
Farkhutdinov R.G., Ilyasov R.A., Yumaguzhin F.G., Tuktarova Y.V.,
Shafikova V.M., Abdullin M.F. Biological stimulator for honey bee
colony productivity with fungicidal activity. Biomics, 2014. V. 6 (2).
P. 68-72. |
133.
Ilyasov
R.A., Poskryakov A.V., Nikolenko A.G. New SNP Markers of the Honeybee
Vitellogenin Gene (Vg) Used for Diagnostics of Subspecies Apis
mellifera mellifera L. in Russia. Russian Journal of Genetics, 2015. V.
51 (2), P. 163–168.
New SNP Markers of the Honeybee
Vitellogenin Gene (Vg) Used for Diagnostics of Subspecies Apis
mellifera mellifera L. in Russia
Preservation of
the gene
pool of honeybee subspccies Apis mellifera mellifera is of vital
importance for successful beekeeping development in the northern
regions of Eurasia. An effective method of genotyping honeybee colonies
used in modern science is the mapping of sites of single nucleotide
polymorphism (SN P). The honeybee vitellogenin gene (Vg) encodes a
protein that affects reproductive function, behavior, immunity,
longevity, and social organization in the honeybee Apis mellifera and
is therefore a topical research subject. The results of comparative
analysis of honeybee Vg sequences show that there are 26 SNP sites that
differentiate M and С evolutionary branches and can be used as markers
in selective breeding, DNA-barcoding, and the creation of genetic
passports for A.m. mellifera colonies.
Publication Name:
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. New SNP Markers of the
Honeybee Vitellogenin Gene (Vg) Used for Diagnostics of Subspecies Apis
mellifera mellifera L. in Russia. Russian Journal of Genetics, 2015. V.
51 (2), P. 163–168. |
132.
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Fragment of tRNALeu-COII
sequences from mtDNA of bees from Bashkortostan republic of Russia.
GenBank. 2014. accession numbers KM242632-KM242643
(http://www.ncbi.nlm.nih.gov).
LOCUS KM242632 761 bp DNA
linear INV 21-OCT-2014
DEFINITION Apis
mellifera mellifera isolate 4369 COI-COII intergenic spacer,
partial sequence;
and cytochrome c oxidase subunit II (COII) gene,
partial cds;
mitochondrial.
ACCESSION KM242632
VERSION KM242632
KEYWORDS .
SOURCE
mitochondrion Apis mellifera mellifera (German honeybee)
ORGANISM Apis
mellifera mellifera
Eukaryota;
Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota;
Neoptera; Endopterygota; Hymenoptera; Apocrita;
Aculeata;
Apoidea; Apidae; Apis.
REFERENCE 1
(bases 1 to 761)
AUTHORS
Ilyasov,R.A., Poskryakov,A.V. and Nikolenko,A.G.
TITLE Fragment of
tRNALeu-COII sequences from mtDNA of bees from
Bashkortostan
republic of Russia
JOURNAL
Unpublished
REFERENCE 2
(bases 1 to 761)
AUTHORS
Ilyasov,R.A., Poskryakov,A.V. and Nikolenko,A.G.
TITLE Direct
Submission
JOURNAL Submitted
(29-JUL-2014) Ufa Scientific Center of Russian Academy of
Sciences,
Institute of Biochemistry and Genetics, Prospekt
Oktyabrya, 71,
Ufa, Bashkortostan 450054, Russia
COMMENT
##Assembly-Data-START##
Sequencing
Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES
Location/Qualifiers
source 1..761
/organism="Apis
mellifera mellifera"
/organelle="mitochondrion"
/mol_type="genomic
DNA"
/isolate="4369"
/sub_species="mellifera"
/db_xref="taxon:44477"
/country="Russia:
Bashkortostan Republic, Beloreckii
region,
Kagarmanovo"
/collection_date="10-Jul-2013"
/collected_by="Ilyasov
R.A."
misc_feature
<1..467
/note="COI-COII
intergenic spacer"
gene
468..>761
/gene="COII"
CDS
468..>761
/gene="COII"
/codon_start=1
/transl_table=5
/product="cytochrome
c oxidase subunit II"
/protein_id="AIT97095"
/translation="MSTWFMFMFQESNSYYADNLISFHNMVMMIIIMISALTVYIILD
LFMNKFSNLFLLKNHNIEVIWTIIPIIILLIICFPSLKILYLIDEIVNPFFSIK"
ORIGIN
1 ttttttaact
tttattaaaa ttaataaatt aatataaaat atgaattata tttattaaaa
61 tttaatttat
taaaattttc cacttaattc attttaattt aaaaatataa ttaaataaca
121 atttttaata
aaataaataa ttaattttat ttttatattg aattttaaat tcaatcttaa
181 agatttaatc
tttttattaa aattaataaa ttaatataaa aaataaaaca aaatataaca
241 aaatatattt
attaaaattt aatttattaa aatttcccac ttaattcatt ttaatttaaa
301 aataaattaa
ataacaattt ttaataaaat aaataattaa ttttattttt atattgaatt
361 ttaaattcaa
tcttaaagat ttaatctttt tattaaaatt aataaattaa tataaaaaat
421 aaaacaaaat
ataacaaaat atatttatta aaatttaatt tattaaaatt tccacatgat
481 tcatatttat
atttcaagaa tcaaattcat attatgctga taatttaatt tcatttcata
541 atatagttat
aataatcatt attataattt cagcattaac tgtatatatt attttagatt
601 tatttataaa
caaattttca aatttatttt tattaaaaaa tcataatatt gaagttattt
661 gaacaattat
tccaattatt attctattaa ttatttgttt tccatcatta aaaattttat
721 atttaattga
tgaaattgta aatccttttt tttcaattaa a
// |
131.
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Molecular phylogenetics
of honey bee subspecies Apis mellifera L. by polymorphism gene ND2.
GenBank. 2014. accession numbers KM242606-KM242631
(http://www.ncbi.nlm.nih.gov).
LOCUS KM242606 552 bp DNA
linear INV 21-OCT-2014
DEFINITION Apis
mellifera mellifera isolate 4401 NADH dehydrogenase subunit 2
(ND2) gene,
partial cds; mitochondrial.
ACCESSION KM242606
VERSION KM242606
KEYWORDS .
SOURCE
mitochondrion Apis mellifera mellifera (German honeybee)
ORGANISM Apis
mellifera mellifera
Eukaryota;
Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota;
Neoptera; Endopterygota; Hymenoptera; Apocrita;
Aculeata;
Apoidea; Apidae; Apis.
REFERENCE 1
(bases 1 to 552)
AUTHORS
Ilyasov,R.A., Poskryakov,A.V. and Nikolenko,A.G.
TITLE Molecular
phylogenetics of honey bee subspecies Apis mellifera L.
by polymorphism
gene ND2
JOURNAL
Unpublished
REFERENCE 2
(bases 1 to 552)
AUTHORS
Ilyasov,R.A., Poskryakov,A.V. and Nikolenko,A.G.
TITLE Direct
Submission
JOURNAL Submitted
(25-JUL-2014) Ufa Scientific Center of Russian Academy of
Sciences,
Institute of Biochemistry and Genetics, Prospekt
Oktyabrya, 71,
Ufa, Bashkortostan 450054, Russia
COMMENT
##Assembly-Data-START##
Sequencing
Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES
Location/Qualifiers
source 1..552
/organism="Apis
mellifera mellifera"
/organelle="mitochondrion"
/mol_type="genomic
DNA"
/isolate="4401"
/sub_species="mellifera"
/db_xref="taxon:44477"
/country="Russia:
Bashkortostan Republic, Abzelilovskii
region, Kirdas"
/collection_date="01-Jun-2013"
/collected_by="Ilyasov
R.A."
gene
<1..>552
/gene="ND2"
CDS
<1..>552
/gene="ND2"
/codon_start=2
/transl_table=5
/product="NADH
dehydrogenase subunit 2"
/protein_id="AIT97069"
/translation="FFMNFKYHWFIYLLITIFVLMMNSNNIFIQWMLMEFGTIISISL
INIKSTNKTPSLIYYSVSVISSIFLFFMIIVYLSSISFTKTDTFNFMVQMMFFLKIGT
FPFHFWMIYSYEMMNWKQIFLMSTLIKFIPIYMMVSMTKINSWTLYFLITNSLYISFY
ANKFYTLKKLLACSTIFNSFYFI"
ORIGIN
1 tttcttcata
aattttaaat accactgatt tatttatctt ttaattacta tttttgtatt
61 aataataaat
tccaataata tttttattca atgaatatta atagaatttg gtacaatcat
121 tagaattaga
ttaattaata ttaaatccac aaataaaacc ccaagattaa tttattattc
181 agtatcagta
atttcaagaa tttttttatt ctttataatt attgtatact tatcatccat
241 tagatttact
aaaacagata cttttaattt tatagttcaa ataatatttt ttttaaaaat
301 tggaactttc
ccttttcatt tttgaataat ttattcttat gaaataataa attgaaagca
361 aattttttta
atatcaacat taattaaatt tattccaatt tatataatag tttcaataac
421 taaaattaat
tcatgaacat tatatttttt aattacaaat agattatata tttcatttta
481 tgcaaataaa
ttttatactc taaaaaaatt attagcatgc tcaacaattt ttaattcatt
541 ctatttcatt tt
// |
130.
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Polymorphism of 1 intron
of elongation factor 1 alpha (EF1-alpha) of Apis mellifera mellifera
from Bashkortostan republic in Russia. GenBank. 2014. accession numbers
KM242603-KM242605 (http://www.ncbi.nlm.nih.gov).
LOCUS KM242606 552 bp
DNA linear INV 21-OCT-2014
DEFINITION Apis
mellifera mellifera isolate 4401 NADH dehydrogenase subunit 2
(ND2) gene,
partial cds; mitochondrial.
ACCESSION KM242606
VERSION KM242606
KEYWORDS .
SOURCE
mitochondrion Apis mellifera mellifera (German honeybee)
ORGANISM Apis
mellifera mellifera
Eukaryota;
Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota;
Neoptera; Endopterygota; Hymenoptera; Apocrita;
Aculeata;
Apoidea; Apidae; Apis.
REFERENCE 1
(bases 1 to 552)
AUTHORS
Ilyasov,R.A., Poskryakov,A.V. and Nikolenko,A.G.
TITLE Molecular
phylogenetics of honey bee subspecies Apis mellifera L.
by polymorphism
gene ND2
JOURNAL
Unpublished
REFERENCE 2
(bases 1 to 552)
AUTHORS
Ilyasov,R.A., Poskryakov,A.V. and Nikolenko,A.G.
TITLE Direct
Submission
JOURNAL Submitted
(25-JUL-2014) Ufa Scientific Center of Russian Academy of
Sciences,
Institute of Biochemistry and Genetics, Prospekt
Oktyabrya, 71,
Ufa, Bashkortostan 450054, Russia
COMMENT
##Assembly-Data-START##
Sequencing
Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES
Location/Qualifiers
source 1..552
/organism="Apis
mellifera mellifera"
/organelle="mitochondrion"
/mol_type="genomic
DNA"
/isolate="4401"
/sub_species="mellifera"
/db_xref="taxon:44477"
/country="Russia:
Bashkortostan Republic, Abzelilovskii
region, Kirdas"
/collection_date="01-Jun-2013"
/collected_by="Ilyasov
R.A."
gene
<1..>552
/gene="ND2"
CDS
<1..>552
/gene="ND2"
/codon_start=2
/transl_table=5
/product="NADH
dehydrogenase subunit 2"
/protein_id="AIT97069"
/translation="FFMNFKYHWFIYLLITIFVLMMNSNNIFIQWMLMEFGTIISISL
INIKSTNKTPSLIYYSVSVISSIFLFFMIIVYLSSISFTKTDTFNFMVQMMFFLKIGT
FPFHFWMIYSYEMMNWKQIFLMSTLIKFIPIYMMVSMTKINSWTLYFLITNSLYISFY
ANKFYTLKKLLACSTIFNSFYFI"
ORIGIN
1 tttcttcata
aattttaaat accactgatt tatttatctt ttaattacta tttttgtatt
61 aataataaat
tccaataata tttttattca atgaatatta atagaatttg gtacaatcat
121 tagaattaga
ttaattaata ttaaatccac aaataaaacc ccaagattaa tttattattc
181 agtatcagta
atttcaagaa tttttttatt ctttataatt attgtatact tatcatccat
241 tagatttact
aaaacagata cttttaattt tatagttcaa ataatatttt ttttaaaaat
301 tggaactttc
ccttttcatt tttgaataat ttattcttat gaaataataa attgaaagca
361 aattttttta
atatcaacat taattaaatt tattccaatt tatataatag tttcaataac
421 taaaattaat
tcatgaacat tatatttttt aattacaaat agattatata tttcatttta
481 tgcaaataaa
ttttatactc taaaaaaatt attagcatgc tcaacaattt ttaattcatt
541 ctatttcatt tt
// |
129.
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Polymorphism of gene COI
of Apis cerana from Far East population in Russia. GenBank. 2014.
accession numbers KM242593-KM242602 (http://www.ncbi.nlm.nih.gov).
LOCUS
KM242593 668 bp DNA linear INV 21-OCT-2014
DEFINITION Apis
cerana cerana isolate 3929 cytochrome c oxidase subunit I
(COI) gene,
partial cds; mitochondrial.
ACCESSION KM242593
VERSION KM242593
KEYWORDS .
SOURCE
mitochondrion Apis cerana cerana
ORGANISM Apis
cerana cerana
Eukaryota;
Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota;
Neoptera; Endopterygota; Hymenoptera; Apocrita;
Aculeata;
Apoidea; Apidae; Apis.
REFERENCE 1
(bases 1 to 668)
AUTHORS
Ilyasov,R.A., Poskryakov,A.V., Proshalykin,M.Y. and Nikolenko,A.G.
TITLE
Polymorphism of gene COI of Apis cerana from Far East population in
Russia
JOURNAL
Unpublished
REFERENCE 2
(bases 1 to 668)
AUTHORS
Ilyasov,R.A., Poskryakov,A.V., Proshalykin,M.Y. and Nikolenko,A.G.
TITLE Direct
Submission
JOURNAL Submitted
(25-JUL-2014) Ufa Scientific Center of Russian Academy of
Sciences,
Institute of Biochemistry and Genetics, Prospekt
Oktyabrya, 71,
Ufa, Bashkortostan 450054, Russia
COMMENT
##Assembly-Data-START##
Sequencing
Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES
Location/Qualifiers
source 1..668
/organism="Apis
cerana cerana"
/organelle="mitochondrion"
/mol_type="genomic
DNA"
/isolate="3929"
/sub_species="cerana"
/db_xref="taxon:94128"
/country="Russia:
Primorskii Krai, Vladivostok,
Akademgorodok"
/collection_date="15-May-2010"
/collected_by="Ilyasov
R.A., Proshalykin M.Y."
gene
<1..>668
/gene="COI"
CDS
<1..>668
/gene="COI"
/codon_start=1
/transl_table=5
/product="cytochrome
c oxidase subunit I"
/protein_id="AIT97059"
/translation="LALWSGMLGSSMSLIVRMELSSPGSWINNDQIYNTVVTSHAFLM
IFFMVMPFLIGGFGNWLIPLMLGSPDMAFPRMNNISFWLLPPSLFMLLLSNLFYPSPG
TGWTVYPPLSAYLYHSSPSVDFAIFSLHMSGISSIMGSLNLMVTIMMMKNFSLNYDQI
SLFPWSVFITAILLIMSLPVLAGAITMLLFDRNFNTSFFDPMGGGDPILYQHLFWFFG
HPEV"
ORIGIN
1 ttagccttat
gatcaggaat attaggctca tcaataaggt tgattgttcg catagaatta
61 agatcccccg
gttcatgaat taataatgat caaatttata atacagttgt aacaagacat
121 gcattcctaa
taattttttt tatagttata ccattcctaa ttggaggttt tggaaattga
181 ttaattcctt
taatattagg atctccagat atagcatttc ctcgaataaa taatattaga
241 ttctgattgc
ttcctccttc attatttata ttattattaa gaaatttatt ttatccaaga
301 ccaggaacag
gatgaacagt ttatcctcca ttatctgcat atttatatca ttcatccccc
361 tcagttgatt
ttgcaatttt ttccttacat atatctggaa tctcatcaat tataggatca
421 ttaaatttaa
tagttacaat tataataata aaaaattttt cattaaatta tgatcaaatt
481 tctttatttc
catgatcagt atttattaca gcaattttat taattatatc tcttccagtt
541 ctagctggag
caattacaat attattattt gatcgaaatt ttaatacttc attttttgat
601 ccaataggag
gtggagatcc aattttatat caacatttat tttgattttt tggtcaccca
661 gaagttta
// |
128.
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Polymorphism of
Ascosphaera apis 5.8SrRNA in Bashkortostan republic. GenBank. 2014.
accession numbers KM242589-KM242592 (http://www.ncbi.nlm.nih.gov).
LOCUS
KM242589 533 bp DNA linear PLN 26-OCT-2014
DEFINITION
Ascosphaera apis isolate 4078 internal transcribed spacer 1,
partial sequence;
5.8S ribosomal RNA gene and internal transcribed
spacer 2,
complete sequence; and 28S ribosomal RNA gene, partial
sequence.
ACCESSION KM242589
VERSION
KM242589.1 GI:698364706
KEYWORDS .
SOURCE
Ascosphaera apis
ORGANISM
Ascosphaera apis
Eukaryota; Fungi;
Dikarya; Ascomycota; Pezizomycotina;
Eurotiomycetes;
Eurotiomycetidae; Onygenales; Ascosphaeraceae;
Ascosphaera.
REFERENCE 1
(bases 1 to 533)
AUTHORS
Ilyasov,R.A., Poskryakov,A.V. and Nikolenko,A.G.
TITLE
Polymorphism of Ascosphaera apis 5.8SrRNA in Bashkortostan republic
JOURNAL
Unpublished
REFERENCE 2
(bases 1 to 533)
AUTHORS
Ilyasov,R.A., Poskryakov,A.V. and Nikolenko,A.G.
TITLE Direct
Submission
JOURNAL Submitted
(24-JUL-2014) Ufa Scientific Center of Russian Academy of
Sciences,
Institute of Biochemistry and Genetics, Prospekt
Oktyabrya, 71,
Ufa, Bashkortostan 450054, Russia
COMMENT
##Assembly-Data-START##
Sequencing
Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES
Location/Qualifiers
source 1..533
/organism="Ascosphaera
apis"
/mol_type="genomic
DNA"
/isolate="4078"
/host="Apis
mellifera mellifera"
/db_xref="taxon:5105"
/country="Russia:
Bashkortostan Republic, Davlekanovskii
region,
Mesyagutovo"
/collection_date="01-Jul-2013"
/collected_by="Ilyasov
R.A."
misc_RNA
<1..186
/product="internal
transcribed spacer 1"
rRNA 187..344
/product="5.8S
ribosomal RNA"
misc_RNA 345..511
/product="internal
transcribed spacer 2"
rRNA
512..>533
/product="28S
ribosomal RNA"
ORIGIN
1 ggtgccccta
aacaaggccc tgccgcgcac tcccaccctt gtctacctta cctgttgctt
61 cggcgggcct
gcgggttctc gcgagcctgc tgccggaggg gttagttccc ccctggctag
121 cgtccgccga
agataaacga actccagtcg aagattgaag tctgaagaaa attgataaat
181 aaatcaaaac
tttcaacaac ggatctcttg gttccgacat cgatgaagaa cgcagcgaaa
241 tgcgataagt
aatgtgaatt gcagaattcc gtgaatcatc gaatctttga acgcacattg
301 cgccctctgg
tattccgggg ggcatgcctg tccgagcgtc attgcaaccc tcaagcacgg
361 cttgtgtgtt
gggcgatcgt cccgtcttag gagggacgcg cccgaaaggc agtgacggcg
421 tcgtgttccg
gtgcccgagc gtatggggct ttgtctttcg ctctagtggc ctggccgact
481 gtccggtcta
accatcattt acttctagtg gttgacctcg gatcaggtag ggt
// |
127.
Ilyasov
R.A., Poskryakov A.V., Nikolenko A. G. Polymorphism of Nosema apis
SSUrRNA in Bashkortostan Republic. GenBank. 2014. accession numbers
KM242585-KM242588 (http://www.ncbi.nlm.nih.gov).
LOCUS KM242585 437 bp DNA
linear PLN 26-OCT-2014
DEFINITION Nosema
apis isolate 4079-1 small subunit ribosomal RNA gene,
partial sequence.
ACCESSION KM242585
VERSION
KM242585.1 GI:698364701
KEYWORDS .
SOURCE Nosema apis
ORGANISM Nosema
apis
Eukaryota; Fungi;
Microsporidia; Nosematidae; Nosema.
REFERENCE 1
(bases 1 to 437)
AUTHORS
Ilyasov,R.A., Poskryakov,A.V. and Nikolenko,A.G.
TITLE
Polymorphism of Nosema apis SSUrRNA in Bashkortostan Republic
JOURNAL
Unpublished
REFERENCE 2
(bases 1 to 437)
AUTHORS
Ilyasov,R.A., Poskryakov,A.V. and Nikolenko,A.G.
TITLE Direct
Submission
JOURNAL Submitted
(24-JUL-2014) Ufa Scientific Center of Russian Academy of
Sciences,
Institute of Biochemistry and Genetics, Prospekt
Oktyabrya, 71,
Ufa, Bashkortostan 450054, Russia
COMMENT
##Assembly-Data-START##
Sequencing
Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES
Location/Qualifiers
source 1..437
/organism="Nosema
apis"
/mol_type="genomic
DNA"
/isolate="4079-1"
/host="Apis
mellifera mellifera"
/db_xref="taxon:35231"
/country="Russia:
Bashkortostan Republic, Davlekanovskii
region,
Mesyagutovo"
/collection_date="01-Jul-2013"
/collected_by="Ilyasov
R.A."
rRNA
<1..>437
/product="small
subunit ribosomal RNA"
ORIGIN
1 atgcatgtct
ttgacgtact atgtactgaa agatggactg ctcagtaata ctcactttat
61 ttgatgtacc
ttatacataa ctacgttaaa gtgtagctaa catatgtaca gtaagagtga
121 gacctatcag
ctagttgtta aggtaatggc ttaacaaggc aataacgggt aacggtatta
181 ctttgtaata
ttccggagaa ggagcctgag agacggctac taagtctaag gattgcagca
241 ggggcgaaac
ttgacctatg gatattatct gaggcagtta tgggaagtaa catagttgtt
301 tcacatttta
aacgtatgtg agcagattaa ttggagggca aatcgagtgc cagcagccgc
361 ggtaatactt
gttccaagag tgtgtatgat gattgatgca gttaaaaagt ccgtagttta
421 ttgttaagaa
gcaatat
// |
126.
Ильясов
Р.А., Шареева З.В. Влияние акарицидов на медоносную пчелу при лечении
варроатоза. Аграрная Россия. № 10. 2014. С. 21-22.
Влияние
акарицидов на медоносную пчелу при лечении варроатоза (Effect of
acaricides on honey bees under the treatment against varroatosis)
Показано, что
некоторые
акарнцнды (амитраз и флувалинат) оказывают негативное влияние на
пчелиные семьи. Для лечения варроатоза оптимально использовать только
терапевтические дозы акарицидов. Превышение дозы акарицидов в 1,5 раза
может снизить все характеристики пчелиной семьи в 1,3 раза. Во всех
четырех экспериментальных группах, обработанных флувалинатом и
амитразом, снизились экономически полезные показатели пчелиных семей.
Муравьиная кислота оказывает минимальное негативное влияние на
состояние пчелиной семьи.
It has been shown
that
some akarntsndy (amitraz and fluvalinate) have a negative impact on
bees. For the treatment of varroatosis optimal use only therapeutic
doses acaricides. Doses in excess of 1.5 times acaricides may reduce
all the features of the bee colony is 1.3 times. In all four
experimental groups treated fluvalinate and amitraz, declined
economically useful indicators of bee colonies. Formic acid has minimal
negative impact on the bee colony.
Publication Name:
Ilyasov R.A., Shareeva Z.V. Effect of acaricides on honey bees under
the treatment against varroatosis. Agrarian Russia. V. 10. 2014. P.
21-22. |
125.
Nikolenko A.G., Ilyasov R.A., Poskryakov A.V., Saltykova E.S. The gene
geographic analysis of Burzyan population of Apis mellifera mellifera
L. Materials of international Sixth European Conference of Apidology
"EURBEE 6". Murcia. Spain. 9 -11 September 2014. P. 52-53.
High
honeybee
colony losses in North America and Europe again recalled the importance
of preservation of one’s gene pool (Johnson, 2010). The 43
Apimondia Congress (2013) have noted the research of local aborigine
populations as a key direction of modern conservation beekeeping.
Aborigine honeybee populations are being restored in Sicily (Costa,
2013), Greece, Cyprus (Bouga, Hatjina, 2013) and other parts of Europe.
Since 2008 the gene geographic analysis of Burzyan population of A.m.
mellifera in the South Urals was performed by mitochondrial (tRNA-Leu -
COII) and 9 microsatellite (Ap243, 4A110, A24, A8, A43, Al 13, A88,
Ap049 и A28) markers. The population area, genetic structure and
molecular diversity have been analyzed in this study. In total samples
from 1102 colonies, 206 apiaries and 10 districts in a mountain-wood
zone were analyzed. The sequence of the locus COl-COII mtDNA helped
identify new M line mitotypes, which can be used as genetic markers for
Ural honeybee. The population border was mapped, one is occupying an
area two times greater than previously thought. The total number of
genetically pure colonies reaches nearly 10 thousand. The genetic
differentiation of Burzyan population from other A.m. mellifera in the
Urals was shown with the optimal conservation strategy for the honeybee
in Russian conditions being proposed. |
124.
Ilyasov R.A. Isolates of Dark European honey bees Apis mellifera.
Materials of international SICAMM 13th biennial and BIBBA 50th
anniversary conference. Llangollen, North Wales. 26- 30 september 2014.
P. 15.
Lecturer:
A. Rustem Ilyasov. Russia
Institute of
Biochemistry and Genetics of Ufa Science Centre RAS.
I am a population
geneticist and molecular biologist specialising in honey bees Apis
mellifera. I have worked in the laboratory of biochemistry of insect
adaptability since 2002 and I am studying the honey bee subspecies
A.m.mellifera in Russia. In 2006 I was awarded a PhD degree.
We analyze
polymorphisms
of 9 chromosomal microsatellite loci ap243, 4al I 0, a24, a8, a43, al I
3, ap049, a88, a28, and also a sequencing of loci COI-COII, COI, ND2
mtDNA and loci EFl -a, Vg of nuclear DNA in the laboratory. We also
identify diseases of honey bees by RT-PCR: American and European
foulbrood, Ascospherosis, Nose- matosis and Virus infections.
We also carry out
biochemical research on the immunity of honey bees, and molecular
biological research into the expression of genes of Vitellogenin,
Defensin, Hy- menoptaecin, Abaecin, Cytochrome C Oxidase subunit I and
II, Cytoplasmatic Cu-Zn superoxide dismutase I, Mitochondrial Mn
Superoxide dismutase 2, Catalase, Thiore- doxin reductase,
Mitochondrial thioredoxin peroxidase 3,and Glutathione peroxidase I.
Lecture: Isolates
of Dark European honey bees Apis mellifera
mellifera L. in
the Ural Mountains (Russia)
The Russian Urals
contain a huge pool of dark European honey bees (about 500,000
colonies) mainly in two regions - the Bashkortostan republic (about
300,000 colonies) and Permskii Krai (about 200,000 colonies). Some of
these bees “cave nest” in hollow tree trunks.
We have
demonstrated
their taxonomic identity with Apis mellifera mellifera by DNA analysis:
by sequencing of loci at COI-COII and ND2 in the mtDNA and from
polymorphism analysis of 9 chromosomal microsatellite loci (ap243, 4al
I 0, a24, a8, a43, al I 3, ap049, a88, a28). We have located about five
isolated populations of dark European honey bees in the Urals: in the
national park Shulgan-Tash (South Urals), the wildlife area Altyn-Solok
(South Urals), national park Bashkiriya (South Urals) in the
Bashkortostan republic and the wildlife area Malinovyi Hutor (Middle
Urals) and the national park Visherskii (North Urals) in Permaskii
Krai. This Ural population of dark European honey bees could be a
source for restoration of a gene pool of these bees in North and West
Eurasia. |
123.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Новые SNP маркеры в гене
вителлогенина Vg медоносной пчелы для идентификации Аpis mellifera
mellifera L. Генетика, 2015, том 51, № 2, с. 196–199.
Новые
SNP маркеры
в гене вителлогенина Vg медоносной пчелы для идентификации Аpis
mellifera mellifera L. (New SNP markers in the gene vitellogenin Vg of
honeybees for diagnosis Аpis mellifera mellifera L. in Russia)
Сохранение
генофонда
медоносной пчелы подвида А т. mellifera чрезвычайно важно для успешного
развития пчеловодства в северных регионах Евразии. Генотипирование
пчелиных семей на современном этапе развития науки очень эффективно
проводить на основе сайтов однонуклеотидных замен (SNP). Ген
вителлогенина (Vg) медоносной пчелы, кодирующий белок, участвующий в
регуляции размножения, поведения, иммунитета, продолжительности жизни и
социальной организации особей медоносной пчелы Apis mellifera,
представляет большой интерес для изучения. В результате сравнительного
анализа нуклеотидной последовательности гена Vg медоносной пчелы мы
обнаружили 26 SNP, дифференцирующих пчел эволюционных ветвей М и С,
которые могут быть использованы в качестве генетических маркеров в
селекции подвида А. т. mellifera, в проведении генетического
штрихкодирования и создании генетического паспорта пчелиных семей.
Preservation of
the gene
pool of the honeybee subspecies A m. Mellifera is extremely important
for the successful development of beekeeping in the northern regions of
Eurasia. Genotyping of bee colonies at the present stage of development
of science is very effective to conduct site-based single-nucleotide
substitutions (SNP). Gene vitellogenin (Vg) of the honeybee, encoding a
protein involved in the regulation of reproduction, behavior, immunity,
longevity and social organization of individuals of the honeybee Apis
mellifera, is of great interest for the study. A comparative analysis
of the nucleotide sequence of Vg gene honeybee we found 26 SNP,
differentiating bees evolutionary branches of M and C, which can be
used as genetic markers in breeding subspecies A. m. Mellifera, in
conducting genetic barcoding and the creation of a genetic passport bee
colonies .
Publication Name:
Ilyasov R.A., Poskryakov A.V. Nikolenko A.G. New SNP markers in the
gene vitellogenin Vg of honeybees for diagnosis Аpis mellifera
mellifera L. in Russia. Russian journal of genetics, 2015. V. 51 (2),
P. 194–199. |
122.
Фархутдинов
Р.Г., Ильясов Р.А., Юмагужин Ф.Г., Туктарова Ю.В., Шафикова В.М.,
Абдуллин М.Ф. Фунгицид и стимулятор пчелиной семьи растительного
происхождения. Пчеловодство. 2014. № 9. С. 33-35.
Фунгицид и стимулятор пчелиной
семьи растительного происхождения (Plant origin fungicide and
stimulator of bee colonies)
Аскосфероз
подавляет
развитие семьи и может привести к ее гибели мри отсутствии лечения и
стимуляции иммунитета. Химические препараты с фунгицидным действием
очень эффективны в борьбе с аскосферозом, но обладают побочными
действиями. Применение спиртового экстракта растительного сбора,
обладающего одновременно фунгицидным и стимулирующим эффектом, поможет
также повысить продуктивность пчелиной семьи и снизить затраты на ее
содержание.
Askosphaerosis
suppresses the development of the family and may lead to its demise MRI
untreated and stimulation of immunity. Chemicals with fungicidal action
are very effective in combating askosferozom, but they have side
effects. The use of alcoholic extract of plant collection, has both
fungicidal and stimulating effect, will also help to improve the
productivity of bees and reduce the cost of its maintenance.
Publication Name:
Farkhutdinov R.G., Ilyasov R.A., Yumaguzhin F.G., Tuktarova Y.V.,
Shafikova V.M., Abdullin M.F. Plant origin fungicide and stimulator of
bee colonies. Russian journal of beekeeping. 2014. V. 9. 33-35. |
121.
Ilyasov
R.A., Poskryakov A.V. Phylogenetics of subspecies Apis mellifera L.
(Filogenetyka podgatunków Apis mellifera L.). Pchelovodstvo.
V.
7. 2006. P. 18. (in Polish)
Filogenetyka
pszczół stoi dopiero u progu swego rozwoju i obecnie otwiera
pole do dalszych badań. Końcowy obraz stosunków
filogenetycznych
pomiędzy podgatunkami pszczół winien być uzyskany tylko na
podstawie analizy łącznej wszystkich materiałów gromadzonych
w
tym zakresie przez długi czas.
Gatunek A.
mellifera L.
zajmował areał naturalny obejmujący całą Afrykę i Europę, a także część
Bliskiego Wschodu. Według F. Ruttnera (1992) gatunek dzieli się na 25
podgatunków. W.S. Sheppard i M.D. Meixner (2003) całkiem
niedawno wykryli w górach Tien-szanu w Azji Środkowej
jeszcze
jeden podgatunek – A. m. pomonella. Wielość
podgatunków
wynika zapewne z izolacji i późniejszego nagromadzenia
różnic genetycznych. W wyniku działania czynników
antropogenicznych stale zachodzi intensywna hybrydyzacja
podgatunków. Nastąpiła introdukcja różnych
podgatunków A. mellifera do Ameryki Północnej i
Południowej, Australii i Azji, co dało początek populacjom hybrydowym.
Przypadkowo powstałe populacje pszczół zafrykanizowanych w
Ameryce Południowej – potomkowie A. m. scutellata i
zhybrydyzowanych podgatunków z Europy: A. m. mellifera, A.
m.
ligustica, A. m. carnica, A. m. caucasica i A. m. iberica (D.R. Smith,
1991) – stanowią poważne zagrożenie nie tylko dla ludności,
ale
także dla pszczelarstwa tego regionu.
W związku z
wysokim
poziomem integracji genomów różnych
podgatunków,
co jest skutkiem powszechnej introdukcji pszczół, filogenia
A.
mellifera jest niedopracowana. Przed kilku laty filogenetyka
pszczół opierała się jedynie na badaniu morfometrii (F.
Ruttner,
1992). Pierwsze kryteria dla systematyki wewnątrzgatunkowej A.
mellifera zostały opracowane przez W.W. Ałpatowa (1948) i G. Goetzego
(1940, 1964). Europejski system morfometryczny przybrał ostateczną
postać po modyfikacji dokonanej przez F. Ruttnera (1978).
Według F.
Ruttnera
(1978), zgodnie z charakterystykami morfometrycznymi, gatunek A.
mellifera L. dzieli się na cztery grupy: A, M, C i O (zob. tabela).
Grupie
afrykańskiej
podgatunków (grupa I) M.C. Ariasa i W.S. Shepparda (1996)
odpowiada zaproponowana przez F. Ruttnera (1978) grupa A; grupie
podgatunków Śródziemnomorza Północnego
(grupa IV)
– grupa C; A. m. mellifera (grupa III) – grupa M.
Grupa IV
odpowiada grupie C z wyłączeniem A. m. meda, która według F.
Ruttnera (1988)
należy do grupy
O. M.C.
Arias i W.S. Sheppard (1996) potwierdzają analogię między grupą II a
grupą O. Ich podobieństwo jednak jest tylko zewnętrzne, pod względem
składu różnią się. Grupa O zawiera A. m. meda, ale nie
zawiera
A. m. lamarckii. Hipotezę spokrewnienia przez pochodzenie
podgatunków z Bliskiego Wschodu i Afryki potwierdza skład
grupy
II, która łączy A. m. lamarckii z Egiptu i A. m. meda z
Syrii.
Dwie
próbki A. m. meda mieszczą się w różnych grupach:
jedna
razem z podgatunkami afrykańskimi, druga razem z
północnośródziemnomorskimi. Potwierdza to
hipotezę, że
Bliski Wschód może być ośrodkiem pochodzenia gatunku (F.
Ruttner, 1988; L. Garnery, 1992; M.C. Arias and W.S. Sheppard, 1996).
Dodatkowe badanie podgatunków z Turcji, ze
Śródziemnomorza Wschodniego i Kaukazu, takich jak A. m.
anatoliaca i A. m. caucasica, pozwoli rozstrzygnąć kwestię
pokrewieństwa podgatunków.
Badania A.
Estoupa
(1995) nad siedmioma loci mikrosatelitarnymi – A113, B124,
A7,
A24, A28, A88 i A43 – potwierdzają istnienie i skład trzech
gałęzi ewolucyjnych: M, C i A, które zostały uprzednio
wyróżnione przez F. Ruttnera (1978). Gałąź M jest
reprezentowana
przez trzy populacje z Avignon (Francja Południowa, A. m. mellifera),
Valenciennes (Francja Północna, A. m. mellifera) i Umea
(Szwecja, A. m. mellifera). Gałąź C jest reprezentowana przez populacje
z Forli (Włochy, A. m. ligustica), Berlina (Niemcy, A. m. carnica) i
Chalkidiki (Grecja, A. m. cecropia). Gałąź A reprezentują populacje z
Johannesburga (Afryka Południowa, A. m. scutellata), Cape Town (Afryka
Południowa, A. m. capensis) i Tinznitu (Maroko, A. m. intermissa) (zob.
tabela).
Tabela
porównawcza wyników badań filogenetycznych trzech
autorów wykazuje, że u M.C. Arrias i W.S. Shepparda (1996) z
16
porównywanych podgatunków tylko osiem
podgatunków
odpowiada grupom F. Ruttnera (1988), a u A. Estoupa(1995) z siedmiu
podgatunków – tylko sześć. Być może tłumaczy się
to
różnym znaczeniem ewolucyjnym loci zastosowanych w danym
porównaniu. Każdy locus posiada własny
współczynnik
selekcji, co jest czynnikiem decydującym w ustalaniu częstotliwości
alleli, która stanowi podstawę do określania stopnia
spokrewnienia między porównywanymi podgatunkami.
Metody
morfometryczne,
pomimo swego znaczenia w badaniach filogenetycznych, przy osiągniętym
obecnie poziomie hybrydyzacji podgatunków, a także wobec
silnej
zmienności cech, nie nadają się do stosowania w identyfikacji
podgatunków (N.N. Grankin, 1997). Metody
molekularno-genetyczne,
przy całej swej precyzyjności, także nie mogą pretendować do
doskonałości – ze względu na nierównomierność
nagromadzenia mutacji, istnienie poziomego przenoszenia materiału
genetycznego, niejednoznaczności procesów splicingu i
częstotliwości stosowania kodonów (W.W. Grieczko, 2002; J.J.
Jeśkow, 1995).
Metody
morfometryczne
nie mogą być stosowane odrębnie od molekularno-genetycznych, gdyż każda
cecha morfometryczna na poziomie cząsteczkowym jest kodowana przez
kilka genów, w tym strukturalnych i regulacyjnych, i zależy
od
przypadkowości mutacji w każdym z nich. Metody molekularno-genetyczne
nie mogą wyprzeć metod morfometrycznych, ponieważ bezpośrednim punktem
przyłożenia doboru naturalnego są fenotypy skorelowane z genotypami,
ale nieodzwierciedlające ich bezpośrednio (L.P. Tatarinow, 1984).
Jednak metody molekularno-genetyczne częściej pozwalają uzyskać
jednoznaczne rezultaty. Na przykład identyfikacji
podgatunków A.
m. mellifera i A. m. caucasica dokonuje się według długości
amplifikowanego fragmentu locusu międzygenowego COI-COII mtDNA (J.M.
Nikonorow et al., 1998; A.G. Nikolenko i A.W. Poskriakow, 2002).
W taki
sposób
współczesne badania filogenetyczne prowadzi się z
zastosowaniem
metod zarówno morfologicznych, jak molekularno-genetycznych.
Schematy pokrewieństwa
podgatunków
zbudowane na podstawie korzystania z różnych metod wykazują
określony stopień podobieństwa, gdy chodzi o liczbę grup, często jednak
powstają rozbieżności co do składu każdej z nich. Jest to być może
skutek różnego znaczenia ewolucyjnego i
współczynnika
selekcji loci oraz doboru próbek, które mogły
okazać się
hybrydowymi. |
120.
Ильясов
Р. А., Шареева З. В. Действие флувалината и амитраза на семью пчел.
Пчеловодство. №6. 2014. С. 30-32
Действие флувалината и амитраза
на семью пчел (Effect of fluvalinate and amitraz on bee colony)
Экспериментально
показано, что для лечения варроатоза наиболее оптимально использовать
терапевтические дозы акарицидов на основе флувалината и амитраза.
Превышение их в 1,5 раза при обработке от варроатоза способно ухудшить
биологические и хозяйственно полезные признаки пчелиной семьи.
It is
experimentally
shown that the treatment varroatosis the best use of therapeutic doses
of acaricides on the basis of amitraz and fluvalinate. Excess of 1.5
times in the processing of varroatosis can degrade biological and
economically useful signs of the bee colony.
Publication Name:
Ilyasov R.A., Shareeva Z.V. Effect of fluvalinate and amitraz on bee
colony. Russian journal of beekeeping. V.6. 2014 P. 30-32. |
119.
Ilyasov
R.A., Poskryakov A.V., Nikolenko A.G. Vitellogenin exons (E2, E3, E4,
E5, E6, E7) polymorphisms in Ural population of honeybees Apis
mellifera mellifera L. GenBank. 2014. accession numbers
KJ532124-KJ532147, KJ572285-KJ572320, KJ645883-KJ645894
(http://www.ncbi.nlm.nih.gov).
Apis mellifera
mellifera isolate VgE7-01 vitellogenin (Vg) gene, exon 7 and partial cds
GenBank: KJ532124.1
FASTA Graphics PopSet
Go to:
LOCUS
KJ532124
461 bp
DNA linear
INV 29-JUL-2014
DEFINITION Apis mellifera mellifera isolate VgE7-01
vitellogenin (Vg) gene,
exon 7 and partial cds.
ACCESSION KJ532124
VERSION KJ532124.1
GI:625295217
KEYWORDS .
SOURCE Apis mellifera
mellifera (German honeybee)
ORGANISM Apis mellifera mellifera
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
Aculeata; Apoidea; Apidae; Apis.
REFERENCE 1 (bases 1 to 461)
AUTHORS Ilyasov,R.A., Poskryakov,A.V.
and Nikolenko,A.G.
TITLE Vitellogenin
exons polymorphisms in Ural population of honeybees
Apis mellifera melifera L.
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 461)
AUTHORS Ilyasov,R.A., Poskryakov,A.V.
and Nikolenko,A.G.
TITLE Direct
Submission
JOURNAL Submitted (05-MAR-2014) Ufa
Scientific Center of Russian Academy of
Sciences, Institute of Biochemistry and Genetics, Prospekt
Oktyabrya, 71, Ufa, Bashkortostan 450054, Russia
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES
Location/Qualifiers
source
1..461
/organism="Apis mellifera mellifera"
/mol_type="genomic DNA"
/isolate="VgE7-01"
/sub_species="mellifera"
/db_xref="taxon:44477"
/pop_variant="Kagarmanovo"
/country="Russia: Bashkortostan republic, Beloreckii
region"
/collection_date="01-Jul-2013"
/collected_by="Ilyasov R.A."
gene
<1..>461
/gene="Vg"
mRNA
<1..>461
/gene="Vg"
/product="vitellogenin"
CDS
<1..>461
/gene="Vg"
/codon_start=1
/product="vitellogenin"
/protein_id="AHY24686.1"
/db_xref="GI:625295218"
/translation="FDHDSTNDFVGPKNCLFRKPEHFVASYALISNQCEGDSLNVAKS
LQDHDCIRQERTQQRNVISDSESGRLDTEMSTWGYHHNVNKHCMIHRTQVKETDDKIC
FTMRPVVSCASGCTAVETKSKPYKFHCMEKNEAAMKLKKRIEKGANPDLSQ"
exon
<1..>461
/gene="Vg"
/number=7
ORIGIN
1 ttcgaccacg actcgaccaa cgatttcgtg ggacccaaga actgcctgtt cagaaagccc
61
gaacacttcg tagccagcta cgctttgatc agtaatcaat gcgagggtga ctcgttgaac
121 gtggcgaaat
ctcttcagga tcacgattgc atccgacagg agaggaccca gcagagaaac
181 gtgatcagcg
acagcgaatc gggacgattg gacaccgaga tgtcgacctg gggttaccac
241 cataacgtta
acaaacattg catgatccac aggacccagg taaaggagac cgatgacaag
301 atctgcttca
ccatgcgtcc agtggtctct tgcgcgtctg gttgcaccgc tgtcgagacg
361 aaatcgaagc
cgtacaagtt ccattgcatg gagaagaacg aggccgcgat gaagctgaag
421 aagagaatcg
agaagggcgc caatcctgac ctcagccaga a
// |
118.
Ильясов Р.А., Прощалыкин М.Ю., Поскряков А.В., Лелей А.С., Николенко
А.Г. Популяция восковой пчелы Apis cerana F. в России. Проблемы и
перспективы сохранения генофонда медоносных пчел в современных
условиях: Материалы 1-й Международной научно-практической конференции,
посвященной 145-летию со дня рождения М.А. Дернова (4-5 марта 2014 г.).
Киров: НИИСХ Северо-Востока, 2014. С. 96-101.
Сотрудники
Института биохимии и генетики УНЦ РАН в Уфе в иссле- довательской
работе использовали рабочих особей из 10 семей китайской восковой пчелы
А. сегапа, предоставленные сотрудниками дальневосточного института
почвоведения - Кузнецовым В.Н., Лелеем A.C., Прощалыкиным М.Ю на
территории Хасанского района Приморского края. На основе срав-
нительного кластерного анализа нуклеотидных последовательностей локуса
COI (1 субъединицы цитохром оксидазы) мтДНК китайской восковой пчелы
методом ближайшего соседа построили дендрограмму генетических отноше-
ний А. сегапа разных популяций. На дендрограмме представители А. сегапа
дальневосточной популяции кластеризуются в основном отдельно от пред-
ставителей других популяций и подразделяется на 4 группы, где в 1
группу вошли пчелы с заповедника Кедровая Падь и п. Ромашка. Во 2
группу вошли представители п. Барабаш, п. Ромашка и с. Овчинниково. В 3
группу выделя- ется единственный представитель с п. Ромашка. Четвертая
группа объединя- ет представителей пчел с Академгородка, заповедника
Кедровая Падь и п. Ромашка и представителей приморской, корейской и
японской популяций А.сегапа. Представители каждого вида пчел
группируются отдельно. А.сегапа и A.nuluensis из Малайзии имеют очень
большое генетическое сход- ство по сравнению с другими видами (Ильясов
и др., 2013). В результате проведенных исследований в дальневосточной
популяции восковой пчелы А.сегапа сотрудниками Института биохимии и
генетики УНЦ РАН были выделены 4 генетические группы. Наибольшее
генетическое сходство с другими азиатскими популяциями А.сегапа
наблюдалось у пред- ставителей пчел из Академгородка, заповедника
Кедровая Падь, п. Ромашка. Наибольшее генетическое разнообразие
наблюдалось в популяции пчел 100 п. Ромашка, представители которой не
группируются вместе в один кластер. Предполагается, что для успешного
сохранения популяции восковой пчелы в России необходимо наличие
максимально допустимого уровня генетического разнообразия. Employees of
the Institute of Biochemistry and Genetics, Ufa Science in Ufa in the
study We used dovatelskoy working individuals from 10 families of
Chinese A bee wax segapa provided by employees of the Far Eastern
Institute of Soil Science - Kuznetsov VN, Lele AC, Proshchalykin M.Yu.
the territory of Khasan district of Primorye Territory. On the basis of
comparison enforcement of cluster analysis of nucleotide sequences of
the locus COI (cytochrome oxidase subunit 1) mtDNA Apis cerana by
nearest neighbor built a dendrogram of genetic relations tions A.
segapa different populations. In the dendrogram representatives A.
segapa Far Eastern populations clustered mostly separately from
representatives tives and other populations are divided into 4 groups,
where one group Bees came to Cedar Pad Reserve and n. Chamomile. In the
2nd group included n representatives. Barabash, p. Chamomile and.
Ovchinnikov. In group 3 was isolated It is the only representative from
the claim. Chamomile. The fourth group were combined a bee with
representatives of Akademgorodok, Cedar Pad Reserve and n. Chamomile
and representatives of the seaside, Korean and Japanese populations
A.segapa. Representatives of each species of bees are grouped
separately. A.segapa A.nuluensis and Malaysia have a very high genetic
similarity GUSTs compared to other species (Ilyasov et al., 2013). The
studies in the Far Eastern population bees wax A.segapa the Institute
of Biochemistry and Genetics USC RAS allocated 4 genetic groups. The
largest genetic similarity with other Asian populations A.segapa
observed in pre- sentatives bees from Akademgorodok, reserve Cedar Pad,
p. Chamomile. The greatest genetic diversity was observed in the
population of bees 100 n. Chamomile, whose members are not grouped
together in a single cluster. It is expected that the successful
conservation of the population in bee wax Russia must have the maximum
level of genetic diversity. |
117.
Ilyasov
R.A., Poskryakov A.V., Nikolenko A.G. Fragment of
tRNALeu-COII sequences from mtDNA of bees from Bashkortostan republic
of Russia. GenBank. 2014. accession numbers KF970918-KF970925
(http://www.ncbi.nlm.nih.gov).
Apis mellifera voucher 3513
tRNA-Leu (trnL) gene, partial sequence; tRNALeu-
COII intergenic
spacer, complete sequence; and cytochrome oxidase
subunit II (COII)
gene, partial cds; mitochondrial
GenBank:
KF970918.1
FASTA Graphics
PopSet
Go to:
Next record
LOCUS KF970918
540 bp DNA linear INV 25-FEB-2014
DEFINITION Apis
mellifera voucher 3513 tRNA-Leu (trnL) gene, partial sequence;
tRNA-Leu-COII
intergenic spacer, complete sequence; and cytochrome
oxidase subunit
II (COII) gene, partial cds; mitochondrial.
ACCESSION KF970918
VERSION
KF970918.1 GI:586619662
KEYWORDS .
SOURCE
mitochondrion Apis mellifera (honey bee)
ORGANISM Apis
mellifera
Eukaryota;
Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota;
Neoptera; Endopterygota; Hymenoptera; Apocrita;
Aculeata;
Apoidea; Apidae; Apis.
REFERENCE 1
(bases 1 to 540)
AUTHORS
Ilyasov,R.A., Poskryakov,A.V. and Nikolenko,A.G.
TITLE Fragment of
tRNALeu-COII sequences from mtDNA of bees from
Bashkortostan
republic of Russia
JOURNAL
Unpublished
REFERENCE 2
(bases 1 to 540)
AUTHORS
Ilyasov,R.A., Poskryakov,A.V. and Nikolenko,A.G.
TITLE Direct
Submission
JOURNAL Submitted
(16-DEC-2013) Ufa Scientific Center of Russian Academy of
Sciences,
Institute of Biochemistry and Genetics, Prospekt
Oktyabrya, 71,
Ufa, Bashkortostan 450054, Russia
COMMENT
##Assembly-Data-START##
Sequencing
Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES
Location/Qualifiers
source 1..540
/organism="Apis
mellifera"
/organelle="mitochondrion"
/mol_type="genomic
DNA"
/isolation_source="Birskii
Osinovka Chernikov Q"
/specimen_voucher="3513"
/db_xref="taxon:7460"
/country="Russia"
/collection_date="01-Jun-2012"
/collected_by="R.A.Ilyasov"
/PCR_primers="fwd_name:
e2, fwd_seq: ggcagaataagtgcattg,
rev_name: h2,
rev_seq: caatatcattgatgacc"
gene <1..37
/gene="trnL"
/note="tRNA-Leu"
misc_feature
38..238
/note="tRNA-Leu-COII
intergenic spacer"
gene
239..>540
/gene="COII"
CDS
239..>540
/gene="COII"
/codon_start=1
/transl_table=5
/product="cytochrome
oxidase subunit II"
/protein_id="AHJ78623.1"
/db_xref="GI:586619663"
/translation="MSTWFMFMFQESNSYYADNLISFHNMVMMIIIMISTLTVYIILD
LFMNKFSNLFLLKNHNIEIIWTIIPIIILLIICFPSLKILYLIDEIVNPFFSIKSIG"
ORIGIN
1 tgaacttaag
attcaaatat aaagtatttt taaactttta ttaaaatttc ccacttaatt
61 catattaatt
taaaaataaa ttaataacaa tttttaataa aataaataat taattttatt
121 tttatattga
attttaaatt caatcttaaa gatttaatct ttttattaaa attaataaat
181 taatataaaa
taaaacaaaa tataacagaa tatatttatt aaaatttaat ttattaaaat
241 ttccacatga
tttatattta tatttcaaga atcaaattca tattatgctg ataatttaat
301 ttcatttcat
aatatagtta taataattat tattataatt tcaacattaa ctgtatatat
361 tattttagat
ttatttataa acaaattctc aaatttattt ttattaaaaa atcataatat
421 tgaaattatt
tgaacaatta ttccaattat tattctatta attatttgtt ttccatcatt
481 aaaaatttta
tatttaattg atgaaattgt aaatcctttt ttttcaatta aatcaattgg
//
|
116.
Николенко
А.Г., Ильясов Р.А., Поскряков А.В., Кугейко В.О. Опыт
молекулярно-генетической сертификации пасеки. Пчеловодство. №5. 2013.
С. 14-15.
Опыт
молекулярно-генетической сертификации пасеки (Experience in the
molecular genetics in certification of apiary) Приведен опыт
молекулярно-генетической сертификации племенной пасеки и отбора лучших
семей для дальнейшей племенной работы и получения высококачественных
чистопородных среднерусских маток и пчелиных пакетов. The experience of
molecular genetic certification apiary breeding and selection of the
best families for further breeding and producing high-quality purebred
Central Russian bee queens and packages. Publication Name: Nikolenko
A.G., Ilyasov R.A., Poskryakov A.V., Kugeiko V.O. Experience in the
molecular genetics in certification of apiary. Russian journal of
beekeeping. V.5. 2013 P. 14-15. |
115.
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Unusual COI-COII
intergenic sequences from mtDNA of bees from Udmurtiya republicGenBank.
2007. accession numbers EF676102-EF676104 (http://www.ncbi.nlm.nih.gov).
EF676102
Apis mellifera mellifera COI-COII intergenic spacer, partial sequence;
mitochondrial
GenBank:
EF676102.1
FASTA Graphics
PopSet Go to:
LOCUS
DEFINITION
ACCESSION
VERSION
KEYWORDS
SOURCE
ORGANISM
REFERENCE
AUTHORS
TITLE
JOURNAL
REFERENCE
AUTHORS
TITLE
JOURNAL
FEATURES
source
misc feature
EF67 6102 566 bp
DNA linear INV 04-AUG-2007
Apis mellifera
mellifera COI-COII intergenic spacer, partial sequence; mitochondrial.
EF676102
EF67 6102.1
GI:154183615
mitochondrion
Apis mellifera mellifera (German honeybee)
Apis mellifera
mellifera
Eukaryota;
Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera;
Endopterygota; Hymenoptera; Apocrita;
Aculeata;
Apoidea; Apidae; Apis.
1 (bases 1 to 566)
Ilyasov,R.A.,
Poskryakov,A.V. and Nikolenko,A.G.
Unusual COI-COII
intergenic sequences from mtDNA of bees from
Udmurtiya republic
Unpublished
2 (bases 1 to 566)
Ilyasov,R.A.,
Baymiev,A.K., Poskryakov,A.V. and Nikolenko,A.G. Direct Submission
Submitted
(14-JUN-2007)
Ufa Scientific Center, Institute of Biochemistry and Genetics, Prospekt
Oktabrya, Ufa, Bashkortostan 450054, Russia
Location/Qualifiers
1..566
/organism="Apis
mellifera mellifera" /organelle="mitochondrion"
/mol
type="genomic DNA"
/sub
species="mellifera"
/db
xref="taxon:44477"
/dev stage="adult"
/country="Russia:
Udmurtiya republic, Malo-Purginskii region"
/collected
by="Ilyasov R. A."
/PCR primers="fwd
seq: cacatttagaaattccatta, rev seq: ataaatataaatcatgtgga"
<1..>566
/note="COI-COII
intergenic spacer"
ORIGIN
//
1 aattttaatt
accttttaat atggcagaat aagtgcattg aacttaagat tcaaatataa
61 agtatttttt
aacttttatt aaaattaaca aattaatata aaatatgaat tatatttatt
121 aaaatttaat
ttattaaaat tttccactta attcatttta atttaaaaat ataattaaat
181 aacaattttt
aataaaataa ataattaatt ttatttttat attgaatttt aaattcaatc
241 ttaaagattt
aatcttttta ttaaaattaa taaattaata taaaaaataa aacaaaatat
301 aacgaaatat
atttattaaa atttaattta ttaaaatttc ccacttaatt cattttaatt
361 taaaaataaa
ttaaataacg atttttaata aaataaataa ttaattttat ttttatattg
421 aattttaaat
tcaatcttaa agatttaatc tttttattaa aactagtaaa ttaatataaa
481 aaataaaacc
aaatgtagca aagtgtgttt gttaaaattt aatttattaa aatttcccac
541 gtagttcatt
ttaatttaaa gagaag |
114.
Ильясов Р. А., Гайфуллина Л. Р., Салтыкова Е. С., Поскряков А. В.,
Николенко А. Г. Методы диагностики, профилактики и лечения нозематоза
классического и типа С. Пчеловодство. 2013. № 10. С. 30-32.
Методы
диагностики, профилактики и лечения нозематоза классического и типа С
(Methods of diagnosis, prevention and treatment of classical type of
nosema and of type C) В последние десятилетия классический нозематоз,
вызываемый Nosema apis, активно вытесняется более опасным нозематозом
типа С, вызываемым Nosema ceranae. Основная опасность заключается в
длительном бессимптомном латентном периоде и резком увеличении
численности патогена за небольшой промежуток времени вне зависимости от
сезона года, что может привести к гибели пчелиной семьи. Ранняя
диагностика и лечение нозематоза типа С повышают шансы на сохранение
жизни и здоровья пчел. In recent decades, the classic nosema, called
Nosema apis, actively displaced more nosema dangerous type C caused
Nosema ceranae. The main danger lies in the long-term asymptomatic
latent period and a sharp increase in the number of the pathogen within
a short period time, regardless of the season, which may lead to the
death of bees. Early diagnosis and treatment of nosema disease type C
increase the chances of the preservation of life and health of the
bees. Publication Name: Ilyasov R.A., Gaifullina L.R., Saltykov E.S.,
Poskryakov A.V., Nikolenko A.G. Methods of diagnosis, prevention and
treatment of classical type of nosema and of type C. Russian journal of
beekeeping. 2013. V.10. P. 30-32. |
113.
Ильясов Р. А., Гайфуллина Л. Р., Салтыкова Е. С., Поскряков А. В.,
Николенко А. Г. Роль антимикробного пептида дефенсина в иммунитете
пчелиной семьи. Пчеловодство. №1. 2014. С. 26-28.
Роль
антимикробного пептида дефенсина в иммунитете пчелиной семьи (Role of
antimicrobial peptide defensin in the immunity of the bee colonies)
Дефенсины индуцибельны, контролируются взаимодействием Toll- и
Imd-сигнальных путей и обладают широким спектром антимикробного
действия. Они существуют в виде двух пептидов — дефенсин 1 и
2. Первый
синтезируется в слюнных железах и участвует в формировании
общественного иммунитета, тогда как второй синтезируется клетками
жирового тела и гемолимфы, являясь фактором индивидуального иммунитета
медоносной пчелы. Defensins inducible, controlled interaction Toll- and
Imd-signaling pathways and have broad spectrum antimicrobial activity.
they Are exist as two peptides - defensin 1 and 2. First synthesized in
the salivary glands and is involved in forming public immunity, whereas
the second is synthesized by cells of the fat body and hemolymph, being
a factor of individual immunity honeybee. Publication Name: Ilyasov
R.A., Gaifullina L.R., Saltykov E.S., Poskryakov A.V., Nikolenko A.G.
Role of antimicrobial peptide defensin in the immunity of the bee
colonies. Russian journal of beekeeping. V.1. 2014 P. 26-28.
|
112.
Ильясов Р.А., Прощалыкин М.Ю., Поскряков А.В., Лелей А.С., Николенко
А.Г. Сохранение восковой пчелы А.cerana на Дальнем Востоке.
Пчеловодство. 2013. № 9. С. 56-57.
Сохранение восковой пчелы
А.cerana на Дальнем Востоке (Saving of the wax bees A.cerana at the Far
East)
В дальневосточной
популяции восковой пчелы A.cerana мы обнаружили 4 группы. Наибольшее
генетическое сходство
с другими
азиатскими
особями наблюдалось у представителей пчел из Академгородка, за
поведника Кедровая Падь, п. Ромашка. Наибольшее генетическое
разнообразие наблюдалось в популяции пчел п. Ромашка, представители
которой не группируются вместе в один кластер. Отметим, что для
сохранения полноценной популяции восковой пчелы в России необходимо
сохранить представителей всех четырех генетических групп.
In the Far
Eastern populations bees wax A.cerana we found 4 groups. The highest
genetic similarity
with other Asian
individuals was observed in bees representatives of Akademgorodok, for
the preacher Cedar Pad, p. Chamomile. The greatest genetic diversity
was observed in the population of bees p. Chamomile, whose members are
not grouped together in one cluster. Note that to preserve the full
population of bees wax in Russia is necessary to keep all four genetic
groups.
Publication Name:
Ilyasov R.A., Proshchalykin M.Y., Poskryakov A.V., Lelei A.C.,
Nikolenko A.G. Saving of the wax bees A.cerana at the Far East. Russian
journal of beekeeping. 2013. V. 9. P. 56-57. |
111.
Ильясов Р.А., Прощалыкин М.Ю., Поскряков А.В., Лелей А.С., Николенко
А.Г. Генетическая структура популяции китайской восковой пчелы Apis
cerana Fabricius, 1793 на Дальнем Востоке России. Материалы
всероссийской научной конференции «Современные проблемы
биохимии и биотехнологии». Уфа. 25-27 сентября 2013. С. 29-32.
В
работе были использованы рабочие особи китайской восковой пчелы
A.cerana собранные сотрудниками дальневосточного института почвоведения
- Кузнецовым В.Н., Лелеем А.С., Прощалыкиным М.Ю. Полимеразную цепную
реакцию проводили с универсальными праймерами для локуса COI мтДНК
F-LCO1490 (5'-GGTCAACAAATCATAAGATATTGG-3') и R-LCO2198
(5'-TAACTTCAGGGTGACCAAAAAATCA-3') [Folmer et al., 1994], продукты
которой были просеквенированы. На основе сравнительного кластерного
анализа нуклеотидных последовательностей локуса COI мтДНК китайской
восковой пчелы методом ближайшего соседа была построена дендрограмма
генетических отношений A.cerana разных популяций. На дендрограмме
представители A.cerana дальневосточной популяции кластеризуются в
основном отдельно от представителей других популяций и подразделяется
на 4 группы, где в 1 группу вошли пчелы с заповедника Кедровая Падь и
п. Ромашка. Во 2 группу вошли представители п. Барабаш, п. Ромашка и с.
Овчинниково. В 3 группу выделяется единственный представитель с п.
Ромашка. Четвертая группа объединяет представителей пчел с
Академгородка, заповедника Кедровая Падь, п. Ромашка и представителей
приморской, корейской и японской популяций A.cerana. Представители
каждого вида пчел группируются отдельно. A.cerana и A.nuluensis из
Малайзии имеют очень большое генетическое сходство по сравнению с
другими видами. Таким образом, в дальневосточной популяции восковой
пчелы A.cerana мы обнаружили 4 генетические группы. Наибольшее
генетическое сходство с другими азиатскими популяциями A.cerana
наблюдалось у представителей пчел из Академгородка, заповедника
Кедровая Падь, п. Ромашка. Наибольшее генетическое разнообразие
наблюдалось в популяции пчел п. Ромашка, представители которой не
группируются вместе в один кластер. Для сохранения полноценной
популяции восковой пчелы в России необходимо сохранить представителей
всех четырех генетических групп. We used individual workers Apis cerana
A.cerana collected by the staff of the Far Eastern Institute of Soil
Science - Kuznetsov VN, Lele AS, Proshchalykin MU Polymerase chain
reaction was performed with universal primers locus COI mtDNA F-LCO1490
(5'-GGTCAACAAATCATAAGATATTGG-3 ') and R-LCO2198
(5'-TAACTTCAGGGTGACCAAAAAATCA-3 ') [Folmer et al., 1994] which products
were sequenced. Based on comparative cluster analysis of nucleotide
mtDNA COI sequences locus Apis cerana by the nearest neighbor was
constructed dendrogram of genetic relationship A.cerana different
populations. In the dendrogram representatives A.cerana Far Eastern
populations clustered in substantially separate from members of other
populations and divided into 4 groups, where 1 group consisted of bees
reserve Cedar Pad and n. Chamomile. In the 2nd group included n
representatives. Barabash, p. Chamomile and. Ovchinnikov. The band
released 3 the only representative of a claim. Chamomile. The fourth
group comprises representatives bees Akademgorodok reserve Cedar Pad,
p. Chamomile and representatives seaside, Korean and Japanese
populations A.cerana. Representatives of each species of bees grouped
separately. A.cerana A.nuluensis and Malaysia have a very large genetic
similarity when compared with other species. Thus, in the Far Eastern
populations bee wax we A.cerana We found four genetic groups. The
largest genetic similarity with other Asian populations A.cerana
observed among representatives of bees from Akademgorodok, reserve
Cedar Pad, p. Chamomile. The greatest genetic diversity observed in the
bee population n. Chamomile, whose members are not grouped together of
one cluster. To preserve the full population of bees wax in Russia you
need to save all four genetic groups. |
110.
Ilyasov R.A., Gaifullina L.R., Saltykova E.S., Poskryakov A.V.,
Nikolenko A.G. Defensins in the Honeybee Antiinfectious Protection.
Journal of Evolutionary Biochemistry and Physiology, 2013, Vol. 49, No.
1, pp. 1—9.
Defensins
in the Honeybee Antiinfectious Protection Specific conditions of the
honeybee life honeybee life require the presence of effective
mechanisms of antiinfectious protection whose one of the most important
components are defensins—the family of antimicrobial
peptides. In the
honeybee, defensins are present in the form of two different
peptides—defensin 1 and 2 that are similar between each other
only by
55.8%. Defensin 1 synthesized in salivary glands plays an important
role in social immunity, whereas defensin 2 synthesized by cells of fat
body and lymph is an important factor in the system of the honeybee
individual immunity. Defensins are inducible, are controlled by
interaction of Toll and Imd signal pathways and have a large specter of
antimicrobial action. Publication Name: Ilyasov R.A., Gaifullina L.R.,
Saltykova E.S., Poskryakov A.V., Nikolaenko A.G. Defensins in the
Honeybee Antiinfectious Protection. Journal of Evolutionary
Biochemistry and Physiology, 2013, V. 49 (1), P. 1-9. |
109.
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Conservation of Ural
population of Apis mellifera mellifera. International conference SICAMM
2012. Landquart, Switzerland, 31 August - 4 September 2012. P. 26-27.
Ap
is mellifera has an extraordinary huge natural area of distribution
spanning from Southern Scandinavia in the North to the Cape of Good
Hope in the South; from Dakar in the West to Altai, the Oman coast and
western borders of China in the East (Ruttner et a l., 1988; Sheppard,
Meixner, 2003). It has been shown that different types of honeybees in
all occupied territory are subspecies and are capable to be crossed
among each others and give prolific descendants. Due to long
geographical isolation and ecological adaptation there is a deep
differentiation of honeybees what led to a big diversity of subspecies.
In Bashkortostan republic there is very hard problem of conservations
of aboriginal bee subspecies A.m.mellifera. For conservations it is
necessary identification hybrid families families, to eliminate their
further distribution. Intergenic locus COI-COII of mtDNA varying among
bees subspecies. There are the genetic markers of this locus allowing
identify of hybrid origin bees colonies, in particular hybridization
with bees from Caucasus (A.m.caucasica and A.m.armeniaca). In
Bashkortostan republic we shown existence pool of the saved aboriginal
bees in the north of republic on territory of several districts
(Tatyshlynskii, Yanaulskii, Birskii, Karaidelski, Mishkinskii,
Ishimbaiskii, Buraevskii and Ask in sk ii) and in the south of republic
on territory of Burzyan district. We studied populations of bees on
territory of several regions of Ural and Volga region. Large
populations of bees A.m.mellifera on our researches was saved on
territory of Permski oblast, Bashkortostan republic and republic
Udmurtiya. The higher degree of hybridization is observed in bee
population on territory of the Chelyabynski and Sverdlovski oblast. On
the basis of the conducted researches it is already possible to make
the map of geographical distribution of natural area of aboriginal bee
A.m.mellifera. Our researches have shown that among hybrid honeybees at
least four local populations of Dark European Honeybees A.m.mellifera
were saved in Urals (Ilyasov et al., 20 06 ; Ilyasov et al., 2007).
This research has show phylogenetics relationship of Russian and
European populations of A.m.mellifera. Genetic relatedness of A
.m.mellifera populations we show using 8 microsatellite locuses, in
particular microsatellites ap243, 4 a1 10, ap049, a113, a43, a8, a8 8,
a28. On the grouping of population influences both community of their
origin and their geographical location in relation to each other.
Cluster analysis was conducted using neighbour joining method. On built
dendrogram Bee population of Iglinski district grouping separately from
other populations of Bashkortostan republic. On dendrogram bee
populations of different regions (Bashkortostan republic, Permski
oblast, republic Udmurtiya and Sverdlovskaya oblast) population of bees
of Sverdlovskaya oblast is disposed separately. Such separate location
of bees population of Iglinskii district of Bashkortostan republic and
Sverdlovskaya oblast is explained by their hybrid origin. Our
laboratory plans to extend genetic researches of bees populations on
all territory of Russia. |
108.
Ильясов Р.А., Макаров В.Л., Поскряков А.В., Николенко А.Г.
Популяционная характеристика среднеуральской медоносной пчелы. Тезисы
докладов всероссийской молодежной конференции «Актуальные
проблемы генетики и молекулярной биологии». Уфа. 2012. С.
33-34.
Среднерусская
пчела занимает широкий ареал обитания. В настоящее время по всему
ареалу среднерусских пчёл преобладают гибриды разных рас пчёл. Пермский
край является северной границей естественного обитания всего вида Apis
meliifera. Целью настоящего исследования являлось продолжение изучения
структуры популяции медоносной пчелы Пермского края.
Результаты
морфометрического анализа показали, что исследованные пчёлы
соответствуют стандарту среднерусской расы. Особенностью является
низкий кубитальный индекс.
Результаты
молекулярно-генетического анализа по локусу COI-COII мтДНК
свидетельствуют об отсутствии значительной генетической дифференциации
пчёл Пермского края и единстве происхождения популяции по материнской
линии от пчел среднерусской расы, аборигенной для Северной Евразии.
Central Russian
bee
takes a habitat. At present the entire range of the Central Russian
bees dominated hybrids of different races of bees. Perm region is the
northern boundary of the natural habitat of the species Apis meliifera.
The purpose of this study was to study the structure of the
continuation of the honey bee population of the Perm region.
The results of
morphometric analysis showed that the studied bees meet the standard of
Central race. A special feature is the low cubital index.
The results of
the
molecular genetic analysis of locus COI-COII mtDNA showed no
significant genetic differentiation bees Perm region and the unity of
the origin of the population through the maternal line of the Central
Russian bee race, native to northern Eurasia. |
107.
Ильясов Р.А., Макаров В.Л., Поскряков А.В., Николенко А.Г.
Популяционная характеристика среднеуральской медоносной пчелы.
Материалы всероссийской молодежной конференции «Актуальные
проблемы генетики и молекулярной биологии». Уфа. 2012. С.
155-158.
ПОПУЛЯЦИОННАЯ ХАРАКТЕРИСТИКА
СРЕДНЕУРАЛЬСКОЙ МЕДОНОСНОЙ ПЧЕЛЫ
Ключевые есть:
Среднерусская пчела, ДНК-маркирование,
митохондриальная
ДНК, марфометрия, популяция
Среднерусская
пчела
занимает широкий ареал обитания. В настоящее время по всему ареалу
среднерусских пчёл преобладают гибриды разных рас пчёл. Пермский край
является северной границей естественного обитания всего вида Apis
mellifera L. Ранее установлено (Петухов, 1996; Ильясов и др., 2006),
что аборигенная популяция медоносной пчелы неоднородна - есть пасеки
как с чистопородными, так и с гибридными пчелиными семьями.
Целью настоящего
исследования являлось продолжение изучения структуры популяции
медоносной пчелы Пермского края. Для этого определяли:
1.
морфометрические признаки рабочих пчёл по общепринятой методике (Билаш,
Кривцов, 1991);
2. кубитальный
индекс крыла рабочих пчёл в программе CooRecorder;
3. полиморфизм
локуса
С01-С0П митохондриальной ДНК, что является генетическим маркером
расовой принадлежности пчел (Николенко и др., 2002).
Для исследования
расовой
принадлежности, а также для определения и оценки степени гибридизации,
были исследованы десять пасек из разных районов Пермского края (Табл.
1).
Препарированные
хитиновые части тела пчёл приклеивали с помощью канцелярского клеящего
карандаша на бумагу и ламинировали. Часть измерений производили с
помощью окуляр-микрометра на бинокуляре МБС-9. Крылья сканировали и в
программе CooRecorder по кубитальному индексу определяли расовую
принадлежность исследуемых пчёл. Стандартными значениями кубитального
индекса среднерусских пчёл считается 60-65%, или меньше 1,7 по
европейским стандартам. Для пчёл южных рас характерен индекс меньше
60%, или больше или равно 1,7.
Полученные
значения
морфометрических признаков по разведенческим пасекам приведены в
таблице 2. В результате установлено, что исследованные пчёлы по всем
признакам, кроме кубитального индекса, соответствуют среднерусским
пчёлам A.m.mellifera.
занесены в
сводную
таблицу 3, при этом пасеки распределены в две группы - чистопородных
(куб. инд.< 1,7) и гибридных (куб. инд.> 1,7).
Результаты
морфометрического анализа и частоты вариантов полиморфного локуса COI -
СОИ мтДНК совместно с породными стандартами для среднерусской и серой
горной кавказской пчёл приведены в таблице 4.
Для среднерусской
пчелы
A.m.mellifera характерны варианты PQ, PQQ, PQQQ межгенного локуса
COI-COII мтДНК по материнской линии. Пчелы, собранные с пасек Пермского
края, характеризовались довольно высоким уровнем частоты встречаемости
комбинаций PQQ мтДНК. По подсчетам частот встречаемости аллелей у всех
исследованных пчёл доля варианта PQQ выше
0,9, что является
показателем их принадлежности по происхождению к среднерусским пчелам в
90 % случаях.
Выводы
1. Результаты
морфометрического анализа показали, что исследованные пчёлы
соответствуют стандарту среднерусской расы. Особенностью является
низкий кубитальный индекс.
2. Результаты
молекулярно-генетического анализа по локусу COI-COII мтДНК
свидетельствуют об отсутствии значительной генетической дифференциации
пчёл Пермского края и единстве происхождения популяции по материнской
линии от пчел среднерусской расы, аборигенной для Северной Евразии.
Population
characteristics Sredneuralskaya Honeybees
The key is:
Central Russian bee, DNA labeling,
Mitochondrial DNA
marfometriya, population
Central Russian
bee
takes a habitat. At present the entire range of the Central Russian
bees dominated hybrids of different races of bees. Perm region is the
northern boundary of the natural habitat of the species Apis mellifera
L. previously established (Petukhov, 1996; Ilyasov et al., 2006) that
the aboriginal populations of the honey bee is not uniform - there
apiary both purebred and hybrid bee colonies.
The purpose of
this
study was to study the structure of the continuation of the honey bee
population of the Perm region. To do this, define:
1. morphometric
signs of working bees on the conventional method (Bilash, Krivtsov,
1991);
2. cubital index
wing working bees in the program CooRecorder;
3. polymorphism
loci C01-S0P mitochondrial DNA, which is a genetic marker race of bees
(Nikolenko et al., 2002).
To study the
race, as
well as to identify and assess the degree of hybridization were
investigated ten apiaries from different areas of the Perm Territory
(Table. 1).
Dissected chitin
body
bees stuck using paper glue stick on paper and laminated. Some
measurements were made using ocular micrometer on a binocular
microscope MBS-9. The wings were scanned and the program CooRecorder
cubital index was measured on race studied bees. The standard values
of cubital index Central Russian bees considered 60-65%, or less than
1.7 according to European standards. For southern bees races
characteristic index less than 60%, or greater than or equal to 1.7.
The values
obtained
for morphometric characters razvedencheskim apiaries are shown in Table
2. As a result, found that the bees studied by all indications, except
for cubital index corresponding Srednerussky bees Ammellifera.
listed in the
summary
table 3, with the apiary divided into two groups - purebred (cu. Ind.
<1.7) and hybrid (cu. Ind.> 1.7).
The results of
morphometric analysis and frequency variants polymorphic locus COI -
SDI mtDNA together with standards for the breed of Central and gray
mountain Caucasian bees are shown in Table 4.
For the Central
Russian
bees Ammellifera characterized options PQ, PQQ, PQQQ intergenic locus
COI-COII maternal mtDNA. Bees collected from apiaries in the Perm
region, characterized by a fairly high frequency of combinations PQQ
mtDNA. According to estimates of the frequency of alleles in all
studied the bees share options above PQQ
0.9, which is an
indication of their belonging by birth to the Srednerussky bees in 90%
of cases.
Findings
1. The results of
morphometric analysis showed that the studied bees meet the standard of
Central race. A special feature is the low cubital index.
2. The results of
the
molecular genetic analysis of locus COI-COII mtDNA showed no
significant genetic differentiation bees Perm region and the unity of
the origin of the population through the maternal line of the Central
Russian bee race, native to northern Eurasia. |
106.
Ильясов Р.А., Поскряков А.В, Николенко А.Г., Брандорф А.З., Ивойлова
М.М. Генетический и фенотипический анализ генофонда популяции Apis
mellifera L. в Кировской области. Биомика. 2012. Т.3. № 1. С. 47-49.
Интродукции
медоносных пчёл из отдаленных регионов началась более ста лет назад, с
переходом от колодного к рамочному содержанию пчелиных семей. Согласно
некоторых исследований, на территории Кировской области количество
пчелиных семей среднерусской расы сохранилось не более 8% (ссылка).
Данная ситуация является результатом массовой пропаганды и интродукции
на территорию области пчелиных маток и пакетов карпатской (А. т.
carpatica), серой горной кавказской (A. m.caucasica Gorb.), а в
некоторые годы краинской (А. т. carnica), итальянской (А. т. ligustica
Spin.) расы и даже дальневосточных пчёл.
По результатам
расчёта коэффициента дифференциации
между популяциями, кроме Кильмезской, отмечены значения близкие к нулю,
что свидетельствует о низком уровне генетической дифференциации
популяций (Fst=-0,154-0,057). Только в Кильмезской локальной популяции
данный показатель составил Fst-0,202, при отрицательном коэффициенте
инбридинга субпопуляций (Fit=-0,149), что является показателем
аутбридинга, и может свидетельствовать об подержании биоразнообразия на
высоком уровне, в связи с чем, данную популяцию можно рассматривать как
источник поддержания генетического разнообразия медоносных пчёл А. т.
mellifera.
Introduction of
honey
bees from remote regions began more than a hundred years ago, with the
transition from Kolodny to the framework content of bee colonies.
According to some studies, in the territory of the Kirov region number
of bee colonies of Central race survived no more than 8% (link). This
situation is the result of mass propaganda and introduction to the
region of queen bees and packages Carpathian (A. m. Carpatica), gray
mountain Caucasian (A. m.caucasica Gorb.), And in some years Krajina
(A. m. Carnica), Italian (A. m. ligustica Spin.) Far Eastern races and
even bees.
As a result of
the calculation coefficient of
differentiation between populations, except Kilmezskoy, marked values
close to zero, which indicates a low level of genetic differentiation
of populations (Fst = -0,154-0,057). Only Kilmezskoy local population
the figure was Fst-0,202, with a negative coefficient of inbreeding
subpopulations (Fit = -0,149), which is an indicator of outbreeding,
and may be indicative of biodiversity used at a high level, and
therefore, this population can be viewed as a source of maintain the
genetic diversity of honey bees A. m. mellifera. |
105.
Симанков М.К., Макаров В.Л., Симанков В.М., Ильясов Р.А., Поскряков
А.В., Николенко А.Г. Морфогенетическая характеристика медоносной пчелы
Пермского края. Материалы третьего международного форума пчеловодов
«Медовый мир». Ярославль. 2012. С. 55-58.
Среднерусская
пчела занимает широкий ареал обитания. В настоящее время по всему
ареалу среднерусских пчёл преобладают гибриды разных рас пчёл. Пермский
край является северной границей естественного обитания всего вида Apis
mellifera L. Ранее установлено (Петухов, 1996; Ильясов и др., 2006),
что аборигенная популяция медоносной пчелы неоднородна
–
есть пасеки как с чистопородными, так и с гибридными пчелиными семьями.
Целью настоящего
исследования являлось продолжение изучения структуры популяции
медоносной пчелы Пермского края. Для этого определяли:
1.
морфометрические признаки рабочих пчёл по общепринятой методике (Билаш,
Кривцов, 1991);
2.
кубитальный индекс крыла рабочих пчёл в программе CooRecorder;
3.
полиморфизм локуса COI-COII митохондриальной ДНК, что является
генетическим маркером расовой принадлежности пчел (Николенко и др.,
2002).
Для исследования
расовой
принадлежности, а также для определения и оценки степени гибридизации,
были исследованы десять пасек из разных районов Пермского края (табл.
1).
Для анализа
морфометрических признаков на каждой пасеке были исследованы до 10%
пчелосемей. В сентябре отбирали по 25 особей от анализируемой семьи,
помещали в картонные емкости и замораживали. Для исследования
кубитального индекса и проведения генетического анализа с каждой пасеки
отбирали по 100 пчёл и фиксировали их в 96% этаноле.
Материалы и методы
Техника
препарирования частей тела пчелы
Обработка пчел,
техника
препарирования частей тела, измерение линейных признаков производилось
в соответствии рекомендациями Г.Д. Билаша, Н.И. Кривцова (1991) и ВНИИ
Пчеловодства. Отпрепарированные хитиновые части тела пчёл приклеивали с
помощью канцелярского клеящего карандаша на бумагу и ламинировали.
Часть измерений производили с помощью окуляр-микрометра на бинокуляре
МБС-9. Крылья сканировали и в программе CooRecorder по кубитальному
индексу определяли расовую принадлежность исследуемых пчёл.
Стандартными значениями кубитального индекса среднерусских пчёл
считается 60-65%, или 1,7 по европейским стандартам. Для пчёл южных рас
характерен индекс меньше 60%, или больше 1,7. Информативную картину
даёт графическое представление, в виде вариационных кривых, значений
кубитального индекса.
В комплексе
морфометрических исследований использовали длину хоботка, длину и
ширину правого переднего крыла, его кубитальный индекс, длину и ширину
четвертого тергита.
Всего исследовано
1600
особей пчел с 98 пчелиных семей с 10 пасек, изготовлено 2800
препаратов, произведено 8400 измерений с помощью окуляр-микрометра на
бинокуляре МБС-9.
Методика
проведения генетического анализа
Исследования по
генетическому анализу проводилась совместно с Р.А. Ильясовым, А.В.
Поскряковым и А.Г. Николенко из Института биохимии и генетики Уфимского
научного центра РАН. Основу генетического анализа составил
установленный ранее полиморфизм межгенного локуса COI-COII у
представителей разных подвидов медоносной пчелы Apis mellifera.
Установлено, что протяженный АТ-богатый межгенный участок мтДНК.,
локализованный между генами COI и COII и не кодирующий аминокислотной
последовательности, может быть использован в качестве маркера для
различения подвидов Apis mellifera mellifera (пчела среднерусской расы)
и A.m.caucasica (серая горная кавказская пчела) благодаря
вариабельности длины, обусловленной различным соотношением элементов Р
и Q, где межгенный участок у представителей ветви М (A.m.mellifera),
аборигенных для Пермского края, имеет комбинацию PQQ, тогда как у
представителей ветви С (A.m.caucasica, A.m.camica, A.m.ligustica),
гибридизация с которыми наблюдается на территории Пермского края,
имеется единственный элемент Q. Таким образом, межгенный локус COI-COII
мтДНК у представителей эволюционной ветви С и их гибридов по
материнской линии на 268 п.н. короче межгенного локуса COI-COII мтДНК у
представителей ветви М, и эти локусы легко разделяются при
электрофорезе. Размер продукта ПЦР межгенного локуса COI-COII мтДНК,
включающий и ген тРНКLeu у представителей A.m.mellifera, равен примерно
600 п.н., а у представителей эволюционной ветви С и их гибридов по
материнской линии - 350 п н. Этот маркер был использован нами для
поиска популяций A.m.mellifera.
Для анализа мтДНК
с
каждой пасеки брали по 100 рабочих особей, которых фиксировали в 96%
этаноле и хранили в морозильной камере. Тотальную ДНК выделяли из
летательных мышц пчел смесью гуанидинтиоционат-фенол-хлороформ по
методу P. Chomezynski и N. Sacchi (1987). В качестве генетического
маркера использовали межгенный локус COI-COII мтДНК, полиморфизм
которого для представителей разных подвидов Apis mellifera был
установлен ранее. Полимеразную цепную реакцию (ПЦР) проводили в
термоциклере «Циклотерм» при оптимальном
температурном
режиме. Выделенную ДНК проверяли на качество в 1,5 % агарозном геле.
Продукты ПЦР электрофоретически фракционировали в полиакриламидном
геле, после чего окрашивали бромистым этидием и фотографировали на
трансиллюминаторе.
Результаты и
обсуждения
Морфометрические
признаки пчёл
Морфометрическому
анализу подвергали пчёл с разведенческих пасек края – хоз-во
«Покровское» Осинского района,
«Парасоль»
Пермского района, а также пчёл биостанции ПГПУ
«В.-Кважва»
Добрянского района. В результате подробного морфометрического анализа
были отобраны пчелиные семьи в «племенное ядро»
пасек.
Средние значения морфометрических признаков по пасекам приведены в
таблице 2.
В результате
установлено, что исследуемые пчёлы по всем признакам, кроме
кубитального индекса соответствуют среднерусским пчёлам.
Кубитальный
индекс крыла медоносной пчелы
Средние значения
кубитального индекса занесены в сводную таблицу 3, при этом пасеки
распределены в две группы – чистопородных (куб. инд.≤
1,7) и
метизированных (куб. инд. > 1,7).
Построенные
вариационные
кривые значений кубитального индекса дают наглядную информативную
картину реального расположения признака (Рис. 1-10).
Дополнительный
пик (или
«горб») в интервалах не свойственных
«чистым»
расам – признак отдалённой гибридизации не смотря на то, что
среднее значение кубитального индекса соответствует стандарту
среднерусской расы ≤ 1,7 (Рис. 1). Иногда это единственный
признак
гибридизации, поскольку средняя величина кубитального индекса и других
мофометрических признаков может соответствовать допустимым для
А.m.mellifera значениям.
На отдельных
пасеках в
распределении значений пчёл в интервале 1,7-2,1 наблюдается избыточное
количество пчёл в сравнении с нормальным, что так же свидетельствует о
гибридизации с пчёлами южных рас.
Пик, на который
приходится максимум встречаемости пчёл группы
«метезированных» пасек, в интервале 1,7-1,9
– можно
интерпретировать как проявление собственно гибридных пчёл (Рис. 7-10).
Таким образом,
построенные вариационные кривые наглядно свидетельствуют о некоторой
степени гибридизации пчёл исследованных пасек. Возможно это является
особенностью экотипа среднерусских пчел Пермского края.
Молекулярно-генетический
анализ пчёл
Кроме
морфометрического
был проведён молекулярно-генетический анализ пчёл пяти пасек края.
Результаты первичного морфометрического анализа и частоты вариантов
полиморфного локуса COI — C0 II мтДНК вместе с породными
стандартами для среднерусской и серой горной кавказской пчёл приведены
в таблице 4.
Пчелы, собранные
с пасек
края, характеризовались довольно высоким уровнем частоты встречаемости
комбинаций PQQ мтДНК. Для среднерусской пчелы A.m.mellifera характерны
локусы PQ, PQQ, PQQQ (Cornuet and Garnery, 1991) по материнской линии.
По подсчетам частот встречаемости аллелей у всех исследованных пчёл
доля аллеля PQQ выше 0,9.
Значение
коэффициента дифференциации Fst между пятью локальными популяциями
А.m.mellifera при анализе микросателлитньх локусов 4а110 и ар243
ядерной ДНК изменялось в пределах от 0,028 до 0,123 (Табл. 5). Между
большинством локальных популяций значение Fst близко к нулю и
свидетельствует об отсутствии значительной генетической дифференциации.
Отдельное внимание следует обратить на добрянскую локальную популяцию
(В.-Кважва), где коэффициент Fst между ней и другими популяциями
колеблется между 0,388 и 0,625 что намного больше, чем между остальными
локальными популяциями. Это может свидетельствовать о значительных
генетических различиях по отцовской линии.
Таким образом,
проведенные исследования показали, что ни один из использованных
методов не стоит абсолютизировать. Поскольку аборигенными пчелами для
всего Поволжья, в том числе и Пермского края были среднерусские пчелы,
то есть пчелы подвида Apis mellifera mellifera L, а завезенные семьи
южных подвидов составляли небольшой процент от общего количества
разводимых пчел, это привело к тому, что большая часть местных пчел
имеет гибридизацию по отцовской линии. Большая вариабельность
морфологических признаков, появившаяся в результате гибридизации
привела к тому, что часть гибридных пчел может также по экстерьеру
соответствовать A.m.mellifera. Поэтому достоверные результаты могут
быть получены только при использовании как морфологических, так и
молекулярно-генетических методов исследования, охватывающих не только
митохондриальный, но и ядерный геномы.
Полученные нами
результаты сравнительных пуляционно-генетических исследований
прикамских пчел показали, что сочетание относительно высоких долей
морфотипа характерного для A.m.mellifera и частот PQ, PQQ, PQQQ может
свидетельствовать о том, что исследованные пчёлы имеют происхождение от
среднерусских пчел. Некоторые отклонения от стандарта среднерусских
пчел могут объясняться как незначительной гибридизацией, так и
особенностями экотипа среднерусских пчел Пермского края.
Выводы
1.
Результаты морфометрического анализа показали, что популяция
пчёл
Пермского края соответствуют стандарту среднерусской расы.
2.
Вариационные кривые значений кубитального индекса показывают
как
гибридное, так и чистопородное происхождение пчел. Отклонение индекса
от общепризнанного стандарта Apis mellifera mellifera возможно является
особенностью экотипа среднерусских пчел Пермского края.
3.
Результаты молекулярно-генетического анализа по локусу COI-COII мтДНК и
двум микросателлитным локусам ap243 и 4a110 свидетельствуют об
отсутствии значительной генетической дифференциации популяции пчёл
Пермского края и единстве происхождения популяции по материнской линии
от пчел среднерусской расы, аборигенной для Северной Евразии.
Central Russian
bee
takes a habitat. At present the entire range of the Central Russian
bees dominated hybrids of different races of bees. Perm region is the
northern boundary of the natural habitat of the species Apis mellifera
L. previously established (Petukhov, 1996; Ilyasov et al., 2006) that
the aboriginal populations of the honey bee is not uniform - there
apiary both purebred and hybrid bee colonies.
The purpose of
this
study was to study the structure of the continuation of the honey bee
population of the Perm region. To do this, define:
1. morphometric
signs of working bees on the conventional method (Bilash, Krivtsov,
1991);
2. cubital index
wing working bees in the program CooRecorder;
3. polymorphism
locus COI-COII mitochondrial DNA, which is a genetic marker race of
bees (Nikolenko et al., 2002).
To study the
race, as
well as to identify and assess the degree of hybridization were
investigated ten apiaries from different areas of the Perm Territory
(Table. 1).
For the analysis
of
morphometric characters in each apiary were examined up to 10% of bee
colonies. In September 25 individuals were selected from families
analyzed were placed in cardboard containers and frozen. To investigate
the cubital index and a genetic analysis were taken from each apiary
100 bees and fixed in 96% ethanol.
Materials and
methods
Technique of
preparation of the body bees
Processing of
bees,
equipment preparation of the body, the measurement of linear features
was carried out in accordance with the recommendations GD Bilash, NI
Krivtsov (1991) and the Institute of Beekeeping. The prepared chitin
body bees stuck using paper glue stick on paper and laminated. Some
measurements were made using ocular micrometer on a binocular
microscope MBS-9. The wings were scanned and the program CooRecorder
cubital index was measured on race studied bees. The standard values
of cubital index Central Russian bees considered 60-65%, or 1.7
according to European standards. For bees southern races characteristic
index is less than 60%, or greater than 1.7. Informative picture gives
a graphical representation of variation curves, the values of cubital
index.
The complex
morphometric
studies used long proboscis, length and width of the right front wing,
his cubital index, length and width of the fourth tergite.
Total studied
1600
individuals with 98 bee bee colonies from 10 apiaries, made
preparations in 2800, produced 8,400 measurements using ocular
micrometer on a binocular microscope MBS-9.
Methods of
genetic analysis
Studies on the
genetic
analysis was conducted jointly with RA Ilyasov, AV Poskryakovym and AG
Nikolenko from the Institute of Biochemistry and Genetics, Ufa
Scientific Center, Russian Academy of Sciences. The basis of genetic
analysis was installed earlier polymorphism intergenic locus COI-COII
representatives of different subspecies of the honeybee Apis mellifera.
It was found that the extended AT-rich intergenic site mtDNA. Localized
between genes and COI COII and encoding the amino acid sequence can be
used as a marker to distinguish between subspecies Apis mellifera
mellifera (honeybee of Central race) and Amcaucasica (gray mountain
Caucasian bee) due to variability in the length due to different ratios
of elements P and Q, where the representatives of intergenic site
branches of M (Ammellifera), native to the Perm region, has a
combination of PQQ, whereas representatives of branches with
(Amcaucasica, Amcamica, Amligustica), Hybridization which is observed
in the Perm region, there is a unique element of Q. Thus, intergenic
locus COI-COII mtDNA from representatives of evolutionary branches with
their hybrids and maternal 268 bp short intergenic locus COI-COII mtDNA
from representatives of branches of M and these loci are easily
separated by electrophoresis. The size of the PCR product intergenic
locus COI-COII mtDNA gene and comprising the representatives tRNKLeu
Ammellifera, is about 600 bp, and the representatives of the
evolutionary branches with their hybrids and the maternal line - 350 n
n. This marker was used to search for our populations Ammellifera.
For the analysis
of
mtDNA from each apiary took 100 working individuals, which were fixed
in 96% ethanol and stored in a freezer. Total DNA was isolated from
muscle flying bee mixture guanidintiotsionat-phenol-chloroform method
P. Chomezynski and N. Sacchi (1987). As the genetic marker used
intergenic locus COI-COII mtDNA polymorphisms for which representatives
of different subspecies Apis mellifera has been installed earlier.
Polymerase chain reaction (PCR) was performed in a thermal cycler
"Tsikloterm" at the optimum temperatures. The isolated DNA was checked
on quality in a 1.5% agarose gel. PCR products were fractionated
electrophoretically in a polyacrylamide gel, then stained with ethidium
bromide and photographed on a transilluminator.
Results and
Discussion
Morphometric
characters bees
Morphometric
analysis
were bees from apiaries razvedencheskih region - host of "Pokrovskoye"
Osa region, "Parasol" the Perm region, as well as bees biostation PGPU
"V.-Kvazhva" Dobriansky area. As a result of detailed morphometric
analysis were selected bee colonies in the "tribal core" apiaries. The
mean values of morphometric characters of apiaries are shown in Table
2.
As a result, it
found that the bees studied by all indications, except for cubital
index correspond Srednerussky bees.
Cubital index
wing honeybee
The average
values of
cubital index are included in the summary table 3, with the apiary
divided into two groups - purebred (cu. Ind.≤ 1.7) and
metizirovannyh (cu. Ind.> 1.7).
Built variation
curves cubital index values give a clear picture of the actual
location of the informative sign (Fig. 1-10).
Additional peak
(or
"hump") at intervals not peculiar to the "pure" races - a sign of
distant hybridization despite the fact that the average value of the
cubital index complies with the race of Central ≤ 1,7 (Fig. 1).
Sometimes it's the only sign of hybridization, since the average value
of cubital index and other signs can match mofometricheskih valid for
A.m.mellifera values.
At some apiaries
in the
distribution of values in the range of 1.7-2.1 bees observed an
excess amount of bees than normal, which also suggests hybridization
with bees southern races.
Peak, which
accounts for
a maximum occurrence of bees group "metezirovannyh" apiaries in the
range of 1.7-1.9 - can be interpreted as a manifestation of the actual
hybrid bees (Fig. 7-10).
Thus, the built
variation curves clearly demonstrate a certain degree of hybridization
bees apiaries studied. Perhaps this is a feature of the Central Russian
bee ecotype Perm.
Molecular genetic
analysis of bees
Additionally
morphometric was conducted molecular genetic analysis of five bees
apiaries edge. The results of the primary morphometric analysis and
frequency variants polymorphic locus COI - C0 II mtDNA with the breed
standards for central Russia and gray mountain Caucasian bees are shown
in Table 4.
Bees collected
from
apiaries the region, characterized by a fairly high frequency of
combinations PQQ mtDNA. For the Central Russian bees Ammellifera
characterized loci PQ, PQQ, PQQQ (Cornuet and Garnery, 1991) through
the maternal line. According to estimates of the frequency of alleles
in all studied the bees share allele PQQ above 0.9.
Fst
value of the
coefficient of differentiation between the five local populations when
analyzing A.m.mellifera mikrosatellitnh loci 4a110 ar243 and nuclear
DNA varied from 0.028 to 0.123 (Table. 5). In the majority of the local
populations Fst value close to zero indicates the absence of
significant genetic differentiation. Special attention should be paid
to the local population Dobriansky (B.-Kvazhva), where the coefficient
Fst between it and other populations varies between 0.388 and 0.625 is
much higher than among the rest of the local populations. This may
indicate a significant genetic differences on the paternal side.
Thus, studies
have shown
that none of the methods used is not absolute. Since the native bees
for the whole Volga region, including Perm Krai were Central Russian
bees, ie bee subspecies Apis mellifera mellifera L, and the family of
the southern subspecies imported accounted for a small percentage of
the total farmed bees, this has led to the fact that most of the local
bees hybridization is paternal. Large variability of morphological
characters that appeared as a result of hybridization has led to the
fact that part of the hybrid bees can also match the exterior
Ammellifera. Therefore, accurate results can be obtained only by using
both morphological and molecular genetic research methods, covering not
only the mitochondrial, and nuclear genomes.
Our results of
comparative population genetic studies Kama bees showed that the
combination of the relatively high proportion of morphotype Ammellifera
characteristic frequencies and PQ, PQQ, PQQQ may indicate that the bees
have studied the origin of the Central Russian bees. Some deviations
from the standard of the Central Russian bees can be explained as a
minor hybridization and features of the Central Russian bee ecotype
Perm.
Findings
1. The results of
morphometric analysis showed that the population of bees Perm Territory
to meet the standard of Central race.
2. The variation
curve
cubital index values show how hybrid and purebred origin of bees. The
deviation of the index from the generally accepted standard of Apis
mellifera mellifera is a possible feature of the Central Russian bee
ecotype Perm.
3. The results of
the
molecular genetic analysis of the locus of mtDNA COI-COII and two
microsatellite loci ap243 4a110 and showed no significant genetic
differentiation of populations of bees Perm region and the unity of the
origin of the population through the maternal line of the Central
Russian bee race, native to northern Eurasia. |
104.
Ilyasov R.A., Gaifullina L.R., Saltykova E.S., Poskryakov A.V.,
Nikolenko A.G. Review of the Expression of Antimicrobial Peptide
Defensin in Honey Bees Apis Mellifera L. Journal of Apicultural
Science. 2012. Vol.56 No.1. P.115-124.
Review of
the Expression of Antimicrobial Peptide Defensin in Honey Bees Apis
Mellifera
L. Honey bees defensin have a high level of polymorphism and exist as
two
peptides - defensin 1 and 2. Defensin 1 is synthesized in the salivary
glands
and is responsible for social immunity. Defensin 2 is synthesized by
cells of
the fat body and hemolymph is responsible for individual immunity.
Defensins
are inducible and controlled by the interaction of Toll and Imd
signaling
pathways and have a broad spectrum of antimicrobial action. The use of
chitosan
as an immunomodulator has been shown to lead to an increase in the
expression
levels of defensin and abaecin in the honey bee organism. Stimulation
of the
transcriptional activity of the defensin genes will allow for the
control of a
honey bee colony’s immunity level, and reduce the using of
antibiotics and
other chemicals. Publication Name: Ilyasov R.A., Gaifullina L.R.,
Saltykova
E.S., Poskryakov A.V., Nikolenko A.G. Review of the Expression of
Antimicrobial
Peptide Defensin in Honey bees Apis mellifera L. Journal of Apicultural
Science.
2012. Vol.56 No.1. P.115-124.
|
103.
Ильясов Р. А., Гайфуллина Л. Р., Салтыкова Е. С., Поскряков А. В.,
Николенко А. Г. Дефенсины в противоинфекционной защите медоносной
пчелы. Журнал эволюционной биохимии и физиологии. 2012., т. 48, № 5. С.
425-432.
Дефенсины в противоинфекционной
защите медоносной пчелы (Antimicrobial protection of defensins in the
honeybees)
Специфические
условия
жизни медоносной пчелы требуют наличия эффективных механизмов
противоинфекционной защиты, одним из важнейших компонентов которой
являются дефен-сины — семейство антимикробных пептидов. У
медоносной пчелы дефенсины присутствуют в виде двух разных пептидов
—дефенсина 1 и 2, обладающих сходством между собой лишь на
55.8
%. Дефенсин 1, синтезируемый в слюнных железах, выполняет важную роль в
социальном иммунитете, тогда как дефенсин 2, синтезируемый клетками
жирового тела и гемолимфы, является важным фактором в системе
индивидуального иммунитета медоносной пчелы. Дефенсины индуцибельны,
контролируются взаимодействием Toll и Imd сигнальных путей и обладают
широким спектром антимикробного действия.
Specific
conditions of
life of the honeybee require effective mechanisms of anti-infectious
protection, one of the most important components of which are dephenyl
Sina - a family of antimicrobial peptides. In honeybee defensins are
present as two different peptides -defensina 1 and 2 having a
similarity between only 55.8%. Defensin 1, synthesized in the salivary
glands, plays an important role in social immunity, whereas defensin 2,
synthesized by cells of the fat body and hemolymph, is an important
factor in the individual immunity of the honey bee. Defensins
inducible, controlled interaction Toll and Imd signaling pathways and
have a broad spectrum of antimicrobial action.
Publication Name:
Ilyasov R.A., Gaifullina L.R., Saltykov E.S., Poskryakov A.V.,
Nikolenko A.G. Antimicrobial protection of defensins in the honeybees.
Journal of Evolutionary Biochemistry and Physiology. 2012, v. 48 (5) .
P. 425-432. |
102.
Брандорф А.З., Ивойлова М.М., Ильясов Р.А., Поскряков А.В., Николенко
А.Г. Популяционно-генетическая дифференциация медоносных пчел Кировской
области. Пчеловодство. 2012. № 7. С. 14-16.
Популяционно-генетическая
дифференциация медоносных пчел Кировской области (Population genetic
differentiation of honey bees of the Kirov region)
Показаны
результаты
анализа породной принадлежности семей медоносных пчел на территории
Кировской области с использованием популяционно-генетического и
фенотипического методов. Установлено, что, несмотря на гибридизацию
местных пчел другими породами, выявляются ареалы локальных популяций
аборигенной среднерусской породы.
The results of
the
analysis of breed of the families of honeybees in the Kirov region
using population genetic and phenotypic methods. It was found that,
despite the hybridization of native bees other breeds, identifies areas
of local populations of native Central Russian breed.
Publication Name:
Brandorf A.Z., Ivoilova M.M., Ilyasov R.A., Poskryakov A.V. Nikolenko
A.G. Population genetic differentiation of honey bees of the Kirov
region. Russian journal of beekeeping. 2012. V. 7. P. 14-16. |
101.
Непейвода С.Н., Колбина Л.М., Воробьева С.Л., Санникова Н.А.,
Масленников И.В. Ильясов Р.А., Николенко А.Г. Анализ генетической
дифференциации популяций Apis mellifera в Удмуртии. Пчеловодство. 2011.
№ 10. С. 12-13.
Анализ
генетической дифференциации популяций Apis mellifera в Удмуртии
(Analysis of genetic differentiation of populations of Apis mellifera
in Udmurtia republic)
В данной работе
приведены результаты исследований генетического потенциала пчел в
Удмуртской Республике. В ходе сравнительного популяционно-генетического
анализа пчелиных семей определено, что популяции пчел Удмуртии
генетически неоднородны.
This paper
presents the
results of studies of the genetic potential of bees in the Udmurt
Republic. During the comparative population-genetic analysis of bee
colonies is determined that the bee population of Udmurtia genetically
heterogeneous.
Publication Name:
Nepeivoda S.N. Kolbina L.M., Vorobyova S.L. , Sannikov N.A.,
Maslennikov I.V., Ilyasov R.A., Nikolenko A.G. Analysis of genetic
differentiation of populations of Apis mellifera in Udmurtia republic.
Russian journal of beekeeping. 2011. V. 10. P. 12-13. |
100.
Колбина Л.М., Непейвода С.Н., Воробьева С.Л., Санникова Н.А.,
Масленников И.В. Ильясов Р.А., Николенко А.Г. Генетическая
дифференциация популяций Apis mellifera L. в Удмуртской Республике.
Аграрная наука Евро-северо-востока. 2011. № 6 (25). С. 46-50.
Генетическая
дифференциация популяций Apis mellifera L. в Удмуртской Республике
(Genetic differentiation of populations of Apis mellifera L. in the
Udmurt Republic)
В данной работе
приведены результаты исследований генетического потенциала пчел в
Удмуртской Республике. В ходе сравнительного популяционно-генетического
анализа пчелиных семей определено, что популяции пчел Удмуртии
генетически неоднородны.
This paper
presents the
results of studies of the genetic potential of bees in the Udmurt
Republic. During the comparative population-genetic analysis of bee
colonies is determined that the bee population of Udmurtia genetically
heterogeneous.
Publication Name:
Kolbina L.M., Nepeivoda S.N., Vorobyov S.L., Sannikov N.A., Maslennikov
I.V., Ilyasov R.A., Nikolenko A.G. Genetic differentiation of
populations of Apis mellifera L. in the Udmurt Republic. Agricultural
science Euro-north-east. 2011. V. 6 (25). P. 46-50. |
099.
Ilyasov R.A., Kutuev I.A., Petukhov A.V., Poskryakov A.V., Nikolenko
A.G. Phylogenetic relationships of dark european honeybees Apis
mellifera mellifera L. from the Russian Ural and West European
populations. Journal of Apicultural Science. 2011. V. 55. No. 1. P.
67-76.
Phylogenetics
relationships of dark european honeybees Apis mellifera mellifera L.
from the
Russian ural and west european populations A mitochondrial DNA region
covering
5'-end of the gene of the second subunit NADH dehydrogenase (ND2), was
PCR
amplifi ed in Dark European Honeybees Apis mellifera mellifera from the
Urals
(Russia) region and in the presumed Apis mellifera macedonica from the
Ukraine.
Phylogenetic analysis of sequenced DNA samples with GenBank
(http://www.ncbi.nlm.nih.gov) data showed the existence of four
evolutionary
branches where the Ural honeybees were grouped with European A. m.
mellifera,
and Ukrainian honeybees with European A. m. macedonica. These results
suggest
the genetic relationship of the Russian Urals and the European
populations of
A. m. mellifera. These data have allowed us to put forward the
hypothesis that
the subspecies A. m. mellifera, is a unique specimen of evolutionary
branch M. Publication
Name: Ilyasov R.A., Kutuev IA, Petukhov A.V., Poskryakov A.V.,
Nikolenko A.G.
Phylogenetics relationships of dark european honeybees Apis mellifera
mellifera
L. from the Russian Ural and west european populations. Journal of
Apicultural
Science. 2011. V. 55 (1). P. 67-76.
|
098.
Хажеева Р.Р., Ильясов Р.А. Популяции темной лесной пчелы Apis mellifera
mellifera L. Урала и Поволжья. Mатериалы докладов Международной
научно-практической конференции "Современные проблемы биологии и
экологии". Махачкала. 2011. C. 212-213.
Медоносная
пчела Apis mellifera L. в различных природно-климатических условиях
изменялась соответственно условиям обитания. В результате длительного
естественного отбора пчелы стали отличаться по ряду признаков. В разных
биоценозах сформировались местные, географические расы пчел. На основе
морфологических признаков выделяют 28 подвидов (Engel, 1999),
медоносные пчелы вида Apis mellifera L. Наиболее широкое
распространение в практической деятельности человека получили пчелы
итальянской, среднерусской, серая горная кавказской, краинской,
карпатской рас. Развитие сельского хозяйства и транспорта привел к
распространению во всем мире медоносных пчел, что стало началом
гибридизации подвидов. В России огромный естественный ареал охватывает
подвид Apis mellifera mellifera L. (темная лесная пчела).
На территории
республики
Башкортостан многие тысячелетия существует подвид A.m.mellifera,
обладающий хорошей адаптацией к резко континентальному климату горного
Урала и способностью к активному, кратковременному медосбору в условиях
короткого лета (Кожевников, 1929). Но массовый завоз южных пчел привел
к массовой гибридизации и нарушению генетической системы популяции
A.m.mellifera в республики Башкортостан (Газизов, 1987; Билаш и др.,
1996; Гранкин, 1997).
Темная лесная
пчела
имеет ряд сохранившихся локальных популяций на Среднем Урале и в
Поволжье. Исследования на основе морфометрических признаков и анализа
полиморфизма межгенного локуса COI-COII митохондриальной ДНК показал
состояние генофонда популяции A.m.mellifera (Николенко, Поскряков,
2002, Ильясов и др., 2006).
А.В. Петухов с
соав.
(1996) на основе исследования экстерьерных признаков пчел в Пермской
области показали, что местные пчелы неоднородны по своему составу. На
пасеках Уинского, Красновишерского, Нытвенского, Частинского,
Кункурского районов параметры соответствовали параметрам среднерусской
расы. На пасеках Чернушинского, Очерского, Куединского районов признаки
свидетельствовали о гибридизации пчел. Гибридизированные пчелы в
изученной части популяции составляли в среднем 25 %. На этих
территориях для обогащения генофонда проводился обмен матками и
пакетами пчел между областями с целью создания единого массива пчел
прикамской популяции. Авторами были четко выделены генотипически
сходные группы в двух районах: Красновишерском и Уинском.
Исследования А.
В.
Петухова с соавт., на основе морфометрических признаков и Р.А. Ильясова
с соавт. (2006), на основе полиморфизма межгенного локуса COI-COII мт
ДНК позволяли говорить о существовании на Среднем Урале и в Поволжье
локальных популяций A.m.mellifera. Таким образом, были обнаружены
локальные популяции A.m.mellifera: красновишерская, южно-прикамская,
татышлинская и бурзянская. А принадлежность уинской популяции к
A.m.mellifera не подтвердились.
Л.М. Колбиной,
С.Н.
Непейвода (2005) были изучены пасеки шести районов Удмуртской
республики: Завьяловского, Якшур-Бодьинского, Камбарского, Вавожского,
Шарканского и Воткинского. От каждой семьи отбиралось по 30 пчел. Всего
было исследовано 188 семей. По результатам исследований только у 23
семей средние значения морфометрических признаков входили в рамки
среднерусской породы, еще 23 семьи были отнесены к южным породам,
остальные 142 семьи являются гибридными даже по средним значениям. По
результатам исследований выявлено большое подвидовое разнообразие и
высокий уровень гибридизации.
Р.А. Ильясов с
соавт.
(2007) отметили, что на территории Бурзянского, Бирского, Татышлинского
районов существуют локальные популяции Apis mellifera mellifera. Пчёлы,
собранные на пасеках этих районов Республики Башкортостан,
характеризовались довольно высоким уровнем частоты встречаемости
комбинаций PQQ мт ДНК. Для среднерусской пчелы A.m.mellifera характерны
локусы PQ, PQQ, PQQQ (Cornuet, Garnery, 1991) по материнской линии. В
Кушнаренковской, Благовещенской, Иглинской районах выборки популяции
темной лесной пчелы находились в некоторой степени гибридизации. Р.А.
Ильясов с соавт. (2010) собрали и проанализировали медоносные пчелы
A.m.mellifera из заповедника Шульган-Таш Бурзянского района республики
Башкортостан, из Башкирской опытной станции пчеловодства Иглинского
района республики Башкортостан и из Юсьвенского района Коми-Пермяцкого
округа Пермского края. Проведенный анализ трех удаленных друг от друга
популяций показал, что сохранились локальные популяции медоносной пчелы
подвида A. m. mellifera, которые способны к длительному существованию
во времени (Ильясов с соавт., 2010).
213
Л. М. Колбина
(2009)
провела сравнение популяции пчел Западного Предуралья с гибридной
популяцией Иглинского района республики Башкортостан на основе анализа
ядерной и мт ДНК. Результат анализа показал обособленность Завьяловской
популяции пчёл от Комбарской, Мало-Пургинской, Глазовской, Можгинской,
Шарканской и Иглинской разделенные на две достоверно отличающиеся друг
от друга группы, внутри которых не наблюдаются статистически значимой
генетической дифференциации. На территории Западного Предуралья
наблюдается генетически подразделенная популяция пчёл среднерусской
расы, частично гибридизированная с подвидами из южных регионов.
А.Н. Талипов
(2007) проводил исследования пчел районов Башкирского Зауралья:
Учалинского,
Абзелиловского,
Баймакского, Зианчуринского, Зилаирского, Белорецкого, Хайбуллинского и
полученные данные сопоставил с пчелами из пасек Бурзянского района
горно-лесной зоны Башкортостана. Изучение пчелы из пасек Бурзянского
района горно-лесной зоны Башкортостана показало, что там находится
основное генетическое ядро диких бортевых пчел. Морфологическая и
генетическая дифференциация пчел Башкирского Зауралья по сравнению с
бурзянской бортевой указывали на процессы гибридизации, представляющие
угрозу чистоте ее генофонда.
Таким образом, на
Урале
и в Поволжье генетическая структура популяций A.m.mellifera изучена
недостаточно. В связи с этим в дальнейшем планируем детальное изучение
генетической структуры популяции темной лесной пчелы на Урале.
A honey bee Apis
mellifera L. in different climatic conditions varied environmental
conditions, respectively. As a result of a long natural selection bees
began to differ on a number of grounds. In different biological
communities formed local geographical races of bees. On the basis of
morphological characters distinguish 28 subspecies (Engel, 1999),
honeybees Apis mellifera L. species most widely used in practice people
received the Italian bee, central Russia, gray mountain Caucasian
Krajina, Carpathian races. The development of agriculture and transport
has led to the worldwide dissemination of honeybees that was the
beginning of hybridizing subspecies. Russia has huge natural range
covers subspecies of Apis mellifera mellifera L. (dark forest bee).
On the territory
of the
Republic of Bashkortostan for many millennia there subspecies
Ammellifera, has a good adaptation to the extreme continental climate
of the Urals Mining and the ability to take an active, short-term honey
flow in the short summer (Kozhevnikov, 1929). But the massive
importation of bees led to the Southern hybridization and mass
violation of the genetic system Ammellifera population in the Republic
of Bashkortostan (Gazizov 1987; Bilash et al., 1996; Grankin, 1997).
The dark forest
bee has
a number of surviving local populations in the Middle Urals and the
Volga region. Studies based on morphometric traits and polymorphism
analysis of intergenic locus COI-COII mitochondrial DNA showed the
state of the gene pool of the population Ammellifera (Nikolenko,
Poskryakov, 2002, Ilyasov et al., 2006).
AV Petukhov with
Soave.
(1996) based on a study of exterior signs of bees in the Perm region
showed that native bees are heterogeneous in composition. On apiaries
Uinskogo, Krasnovishersky, Nytvensky, Chastinskogo, Kunkurskogo areas
settings match the settings of Central race. On apiaries Chernushinsky,
Ocher, Kuedinsky areas showed signs of hybridization bees. Hybridized
bees in a part of the population studied averaged 25%. In these areas,
to enrich the gene pool held an exchange queens and packages of bees
between regions with the aim of creating a single array bee populations
in Kama region. The authors clearly marked genotypically similar groups
in two areas: Krasnovishersky and Uinskom.
Research AV
Petukhov et
al., Based on the morphometric characters and RA Ilyasov et al. (2006),
based on the polymorphism of the intergenic locus COI-COII mt DNA
suggests the existence of the Middle Urals and the Volga region of
local populations Ammellifera. Thus, local populations were found
Ammellifera: Krasnovishersk, South Prikamskaya, tatyshlinskaya and
Burzyan. A membership to the population uinskoy Ammellifera not
confirmed.
LM Kolbina, SN
Nepeivoda
(2005) were studied apiary six districts of the Udmurt Republic:
Zavyalovsky, Yakshur-Bodyinsky, Kambarka, Vavozh, Sharkansky and
Votkinsk. From each family were selected to 30 bees. There were studied
188 families. According to the research only 23 families mean values
of morphometric characters are within the scope of Central Russian
breed, another 23 families were assigned to the southern species, the
remaining 142 families are hybrid even mean values. According to the
research identified a large variety of subspecies and a high level of
hybridization.
RA Ilyasov et al.
(2007)
noted that in the territory Burzyansky, Birsk, Tatyshlinskogo areas
there are local populations of Apis mellifera mellifera. Bees collected
on apiaries those areas of the Republic of Bashkortostan, were
characterized by a fairly high frequency of combinations PQQ mt DNA.
For the Central Russian bees Ammellifera characterized loci PQ, PQQ,
PQQQ (Cornuet, Garnery, 1991) through the maternal line. In
Kushnarenkovsky, Annunciation, iglinsky district sampling dark forest
bee populations are in some degree of hybridization. RA Ilyasov et al.
(2010) collected and analyzed honeybees Ammellifera of reserve
Shulgan-Tash Burzyansky district of the republic of Bashkortostan,
Bashkir Research Station of beekeeping iglinsky district of the
Republic of Bashkortostan and Yusvenskogo region of Komi-Perm district
of the Perm region. The analysis of three widely separated populations
showed that preserved local populations of the honey bee subspecies A.
m. mellifera, which are capable of continued existence in time (Ilyasov
et al., 2010).
213
LM Kolbina (2009)
compared the bee population of the Western Urals hybrid population
iglinsky district of Bashkortostan Republic on the basis of the
analysis of the nuclear DNA and mtDNA. The results showed the isolation
of populations of bees from Zavyalovsky Kombarskoy, Little Purginskoy,
Glazov, Mozhginsky, Sharkan and Iglinsky divided into two significantly
different from each other group, within which no statistically
significant genetic differentiation. On the territory of the Western
Urals observed genetically subdivided population of bees of Central
race, partially hybridized with the subspecies of the southern regions.
AN Talipov (2007)
conducted research on bees of the Bashkir Trans-Urals regions:
Uchalinsky,
Abzelilovsky,
Baimak,
Zianchurinskogo, Zilair, Beloretsk, Haybullinskogo and findings
contrasted with bees from apiaries Burzyansky area mountain-forest zone
of Bashkortostan. The study bees from apiaries Burzyansky area
mountain-forest zone of Bashkortostan showed that there is a
fundamental genetic tree hollow core of wild bees. Morphological and
genetic differentiation of bees of the Bashkir Trans-Urals compared
with wild-hive Burzyan indicates the process of hybridization that
threaten the purity of its gene pool.
Thus, in the
Urals and
the Volga region Ammellifera genetic structure of populations is not
well understood. In this regard, we plan to further detailed study of
the genetic structure of populations of the dark forest bees in the
Urals.
|
097.
Kolbina L., Nepevoda S., Nikolenko A., Ilyasov R., Vorobyeva S.,
Maslennikov I. The race analysis of bee-colonies from Sharkanskiy and
Zavyalovskiy districts of the Udmurt Republic. XLVIII Naukowa
konferencja pszczelarska. Materials of international conference. 2011.
Pszczyna. 2011. P. 31-32.
In our
research the samples from 15 bee-colonies from Koryakino, 19 from
Sharkan, 19 from Lyuk, 15 - Postol, and 5 from Makarovo were used. In
this research we used morphometric and genetic (the polymorphism of
intergenic locus COI-COII) methods (table 1).
The bee-colonies
from
Postol population descend from bees queens of southern races without
admixture of aboriginal race (as show morphological studies,
P<0.001) and the bee-colonies from Lyuk and Makarovi descend
from
populations of bees queen of the Apis mellifera mellifera and have no
genes of southern races. But analysis of the exterior of the
bee-colonies of these two populations suggests that a serious
hybridization of colonies takes place on the drone line, since there
are serious differences with the standard of the Apis mellifera
mellifera (cubital index is less than 57% and almost 20% of bee-
colonies have width of third tergite less than 4.8 mm). The Sharkan and
Koryakino populations have no clear parentage of the maternal line, and
in Sharkan population the few colonies have an abnormal structure of
the intergenic locus COl-COII of mitochondrial DNA - PQ. All of these
confirms the version of heterogeneous parentage of these bee- colonies.
However, morphological characteristics of both these populations,
especially Koryakino population, are close to the Apis mellifera
mellifera and do not satisfy the standard only by cubital index
(<60%) (that occurs not in all bee-colonies). As a result, none
of
the studied populations can be an attribute to the Apis mellifera
mellifera race of bees. |
096.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Популяционная генетика
медоносной пчелы центральной части республики Башкортостан и анализ
таксономии подвидов. Материалы Всероссийской научно-практической
конференции "Мир пчел". Ижевск. 2011. С. 51–57.
Нами
был изучен полиморфизм микросателлитных локусов 4a110, A8, a43 ядерной
ДНК и локуса COI-COII мтДНК в популяции пчел центральной части
республики Башкортостан (Табл. 2).
По результатам
анализа
частот аллелей микросателлитных локусов были получены генетические
расстояния Nei (1978) (Табл. 3), на основе которых кластерным анализом
методом ближайшего соседа была построена дендрограмма генетических
отношений населений пчел изучаемых нами популяций. На дендрограмме
наблюдалось подразделение на 2 крупные ветви. Пчелы центральной части
республики Башкортостан группируются совместно с ранее определенной
гибридной популяцией Иглинского района, что свидетельствует о
гибридизации данной популяции.
По результатам
анализа
наблюдаемых частот аллелей микросателлитных локусов 4a110, A8, a43
ядерной ДНК были рассчитаны коэффициенты инбридинга Fis и Fit,
коэффициент дифференциации Fst и гетерозиготность Ho, Hs и Ht, для
изучаемых нами локальных популяций.
В популяции
центральной
части республики Башкортостан наблюдается аутбридинг Fis=-0,287 и
Fit=-0,199. Кроме того в популяции наблюдается низкий уровень
генетической подразделенности Fst=0,068 и избыток гетерозиготности
Ho=0,634 < Hs=0,486 и Ht=0,504.На основе сравнительного анализа
нуклеотидной последовательности фрагмента гена ND2 мтДНК подвидов
A.m.сarnica, A.m.carpatica, A.m.caucasica, A.m.ligustica было
обнаружено 11 сайтов замен нуклеотидов (Табл. 5).
На основе
кластерного
анализа методом ближайшего соседа фрагментов гена ND2 мтДНК подвидов
пчел была построена дендрограмма, на которой карпатские пчелы, ранее не
определенные однозначно группировались в отдельный кластер, отличный от
подвидов A.m.сarnica, A.m.caucasica и A.m.ligustica (Рис. 2).
Таким образом, на
основе
анализа полиморфизма микросателлитных локусов 4a110, a8, a43 ядерной
ДНК и межгенного локуса COI-COII мтДНК в популяции медоносной пчелы
Кушнаренковского района было показано значительное влияние трутневого
фона гибридного происхождения. Также была определена генетическая
структура популяции медоносной пчелы Кушнаренковского района на основе
анализа полиморфизма микросателлитных локусов 4a110, a8, a43 ядерной
ДНК, которая характеризуется аутбридингом, низким уровнем генетической
подразделенности и избытком гетерозиготности. На основе сравнительного
анализа нуклеотидной последовательности фрагмента гена ND2 мтДНК
показана генетическая обособленность популяции пчел Закарпатской
области Украины.
We have studied
the
polymorphism of microsatellite loci 4a110, A8, a43 nuclear DNA loci and
mtDNA COI-COII in the bee population of the central part of the
republic of Bashkortostan (Tab. 2).
According to the
analysis of allele frequencies of microsatellite loci were obtained
genetic distances Nei (1978) (Table. 3) on which the cluster analysis
method of the nearest neighbor was constructed dendrogram of genetic
relationship bee populations we studied populations. In the dendrogram
observed unit 2 large branches. Bees are a central part of the Republic
of Bashkortostan are grouped together with the previously defined
hybrid populations iglinsky district, indicating that the hybridization
of a given population.
According to the
analysis of the observed allele frequencies of microsatellite loci
4a110, A8, a43 nuclear DNA were calculated inbreeding coefficients Fis
and Fit, Fst differentiation factor and heterozygosity Ho, Hs and Ht,
we study local populations.
The population of
the
central part of the Republic of Bashkortostan is observed outbreeding
Fis = -0,287 and Fit = -0,199. Also in the population have low levels
of genetic subdivision Fst = 0,068 and the excess of heterozygosity Ho
= 0,634 <Hs = 0,486 and Ht = 0,504.Na basis of a comparative
analysis of the nucleotide sequence of a gene fragment ND2 mtDNA
subspecies Amsarnica, Amcarpatica, Amcaucasica, Amligustica was There
are 11 sites nucleotide substitutions (Table. 5).
On the basis of
cluster
analysis by the nearest neighbor ND2 gene fragments of mtDNA subspecies
of bees dendrogram was built on which the Carpathian bees, previously
defined clearly grouped in a separate cluster distinct from the
subspecies Amsarnica, Amcaucasica and Amligustica (Fig. 2).
Thus, based on
the
analysis of polymorphism of microsatellite loci 4a110, a8, a43 nuclear
DNA and the intergenic locus COI-COII mtDNA in honeybee populations
Kushnarenkovsky area has been shown to significantly influence the
background drone of hybrid origin. It was also determined the genetic
structure of honey bee populations Kushnarenkovsky region based on the
analysis of polymorphism of microsatellite loci 4a110, a8, a43 nuclear
DNA, which is characterized by outbreeding, low levels of genetic
subdivision and excess heterozygosity. On the basis of a comparative
analysis of the nucleotide sequence of a gene fragment ND2 shown mtDNA
genetic isolation of populations of bees of the Transcarpathian region
of Ukraine. |
095.
Пискарева Е. М., Ильясов Р. А., Поскряков А. В., Николенко А. Г.
Проблемы сохранения среднерусской расы пчел в республике Башкортостан.
Материалы Всероссийской научно-практической конференции "Актуальные
проблемы изучения биоты Южного Урала и сопредельных территорий". Орск.
2010. С. 55-57.
Перемещение
медоносных пчел (Apis mellifera L.) из одних биоклиматических зон в
другие и вызванная этим гибридизация привели к тому, что на месте
естественно сложившихся местных популяций сформировались помеси
неизвестного происхождения. Изучение их генетических характеристик
позволит выявить резервные очаги местообитания Apis mellifera mellifera
пчелы среднерусской (Ильясов с соавт., 2008).
В связи с
возрастанием
уровня гибридизации популяций A.m.mellifera в России возможность
полного исчезновения генофонда этого подвида становится все большей
реальностью. Факт того, что в условиях глобальной гибридизации пчел еще
сохранились не подверженные гибридизации популяции A.m.mellifera,
послужил некоторым толчком к деятельности по сохранению и
восстановлению генофонда популяций A.m.mellifera в России как наиболее
целесообразного подвида для разведения в климатических условиях России
(Ильясов с соавт., 2010).
Морфометрические
исследования были малопригодны для идентификации A.m.mellifera
в условиях гибридизации, и только с введением молекулярногенетических
методов удалось доказать, что отдельные популяции A.m.mellifera все же
сохранились. Изучение и сохранение биоразнообразия являются одной из
ключевых задач современной экологии. Успешная охрана биоразнообразия,
как условие сохранения устойчивости экосистем и биосферы в целом,
возможно только на основе всестороннего изучения составляющих ее видов
и популяций (Прокофьева, 2004). Для изучения мы взяли 3 популяции пчел
из Альшеевского района республики Башкортостан. Результаты
анализировались сравнительно с результатами по анализу популяций пчел
Красновишерского р-на Пермского края, ранее определенные как
A.m.mellifera, и популяций пчел Красноуфимского р-на Свердловской обл.,
ранее определенные как гибридные популяции (Ильясов с соавт., 2006).
Нами был изучен
полиморфизм микросателлитных локусов ap243, 4a 110, a24, a8, a43, a113,
ap049 ядерной ДНК и полиморфизм локуса COI-COII мтДНК. По результатам
анализа частот аллелей локусов были получены генетические расстояния,
на основе которых кластерным анализом методом ближайшего соседа была
построена дендрограмма генетических отношений населений пчел изучаемых
нами популяций. Дендрограммы были построены отдельно по
микросателлитным локусам и отдельно с использованием локусов ядерной и
митохондриальной ДНК.
По результатам
анализа
межгенного локуса COI-COII мтДНК пасеки северной части района оказалась
полностью гибридной (частота маркера для
A.m.mellifera
PQQ=0%),
пасеки центральной части района - гибридная наполовину (частота
PQQ=60%), пасеки южной части района - семьи пчел имеют происхождение от
Apis mellifera mellifera по материнской линии (частота PQQ=100%).
По результатам
анализа
микросателлитных локусов яДНК (4А110, ар243, ар049, А24, А8, А43, А113)
и межгенного локуса COI-COII мтДНК пасеки северной части района
группируются с пасеками Свердловской области, что говорит о их
гибридном происхождении, пасеки южной части района группируется с
пасекой Пермского края, что говорит о происхождении от Apis mellifera
mellifera , а пасеки центральной части района находятся между первой и
второй группой, что говорит о их большой степени гибридизации.
Такое
расположение можно
объяснить тем, что в популяции пчел Альшеевского района республики
Башкортостан гибридизация шла в большей степени по отцовской линии, чем
по материнской.
Move the honey
bee (Apis
mellifera L.) from one bioclimatic zones in the other and the resulting
hybridization has led to that in place of the existing local
populations naturally formed hybrids of unknown origin. The study of
their genetic characteristics will reveal reserve pockets of habitat
Apis mellifera mellifera bees of Central (Ilyasov et al., 2008).
In connection
with the
increase in the level of hybridization Ammellifera populations in
Russia to the complete disappearance of the gene pool of this
subspecies is becoming more real. The fact that in the global
hybridization of bees still remain not subject to hybridization
population Ammellifera, served as the impetus for some of the
conservation and restoration of the gene pool of populations
Ammellifera in Russia as the most appropriate sub-species breeding in
the climate conditions of Russia (Ilyasov et al., 2010 ).
The morphometric
studies were of little use for identification Ammellifera
in hybridization conditions, and only with the introduction of
molekulyarnogeneticheskih methods failed to prove that the individual
populations Ammellifera still preserved. The study and conservation of
biodiversity is one of the key problems of modern ecology. Successful
protection of biodiversity, as a condition of preservation of stability
of ecosystems and the biosphere as a whole, can only be based on a
comprehensive study of its constituent species and populations
(Prokofiev, 2004). For the study, we took 3 of the bee population
Alsheevsky district of Bashkortostan. The results were analyzed in
comparison with the results of analysis of bee populations
Krasnovishersky district of the Perm region, previously defined as
Ammellifera, and bee populations Krasnoufimsky district of Sverdlovsk
region., Previously defined as hybrid populations (Ilyasov et al.,
2006).
We have studied
the
polymorphism of microsatellite loci ap243, 4a 110, a24, a8, a43, a113,
ap049 nuclear DNA polymorphism locus COI-COII mtDNA. According to the
analysis of allele frequencies loci were obtained genetic distances,
based on which the cluster analysis method the nearest neighbor was
constructed dendrogram of genetic relationship bee populations we
studied populations. Dendrogram were constructed separately for
microsatellite loci and loci separately using nuclear and mitochondrial
DNA.
According to the
analysis of intergenic locus COI-COII mtDNA apiary northern part of the
district was completely hybrid (frequency marker for
Ammellifera PQQ =
0%),
the central part of the apiary - a hybrid half (frequency PQQ = 60%),
the southern part of apiaries - bee colonies are derived from Apis
mellifera mellifera maternal (frequency PQQ = 100%).
According to the
analysis of nuclear DNA microsatellite loci (4A110, ar243, ar049, A24,
A8, A43, A113) and intergenic locus COI-COII mtDNA apiary northern part
of the apiaries are grouped with the Sverdlovsk region, indicating that
their hybrid origin, the apiary southern region grouped apiary with the
Perm region, indicating that the origin of Apis mellifera mellifera,
and the central part of the apiary located between the first and second
group, indicating their high degree of hybridization.
This arrangement
may be
explained by the fact that the population of bees Alsheevsky district
of Bashkortostan hybridization was largely paternal than maternal. |
094.
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Partial sequencing
analysis of gene ND2 honeybee Apis mellifera caucasica from Krasnaya
polyana of Krasnodarskii region of Russia. GenBank. 2010. accession
numbers HQ318729-HQ318730 (http://www.ncbi.nlm.nih.gov).
Apis mellifera
caucasica bio-material 3692 NADH dehydrogenase subunit 2 (ND2) gene,
partial cds; mitochondrial
GenBank:
HQ318730.1
LOCUS HQ318730
540 bp DNA linear INV 22-FEB-2011
DEFINITION Apis
mellifera caucasica bio-material 3692 NADH dehydrogenase
subunit 2 (ND2)
gene, partial cds; mitochondrial.
ACCESSION HQ318730
VERSION
HQ318730.1 GI:323522307
KEYWORDS .
SOURCE
mitochondrion Apis mellifera caucasica (Caucasian honeybee)
ORGANISM Apis
mellifera caucasica
Eukaryota;
Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;
Neoptera;
Endopterygota; Hymenoptera; Apocrita; Aculeata; Apoidea;
Apidae; Apis.
REFERENCE 1
(bases 1 to 540)
AUTHORS
Ilyasov,R.A., Nikolenko,A.G. and Poskryakov,A.V.
TITLE Partial
sequencing analysis of gene ND2 honeybee Apis mellifera
JOURNAL
Unpublished
REFERENCE 2
(bases 1 to 540)
AUTHORS
Ilyasov,R.A., Nikolenko,A.G. and Poskryakov,A.V.
TITLE Direct
Submission
JOURNAL Submitted
(23-SEP-2010) Ufa Scientific Center of Russia Academy of
Sciences,
Institute of Biochemistry and Genetics, Prospect
Octyabrya, Ufa,
Bashkortostan 450054, Russia
FEATURES
Location/Qualifiers
source 1..540
/organism="Apis
mellifera caucasica"
/organelle="mitochondrion"
/mol_type="genomic
DNA"
/isolation_source="Krasnaya
Polyana apiary colony 2"
/sub_species="caucasica"
/bio_material="3692"
/db_xref="taxon:200407"
/country="Russia:
Krasnodarskii region"
gene
25..>540
/gene="ND2"
CDS
25..>540
/gene="ND2"
/codon_start=1
/transl_table=5
/product="NADH
dehydrogenase subunit 2"
/protein_id="ADX94781.1"
/db_xref="GI:323522308"
/translation="MFFMNFKYHWFIYLLITIFVLMMNSNNIFIQWMLMEFGTIISIS
LINIKSTNKTPSLIYYSVSVISSIFLFFMIIVYLSSISFIKTDTFNFMVQMMFFLKIG
TFPFHFWMIYSYEMMNWKQIFLMSTLIKFIPIYMMVSMTKINSWTLYFLITNSLYISF
YANKFYTLKKLL"
ORIGIN
1 aattttatat
atatactatt acttatcttc ttcataaatt ttaaatacca ctgatttatt
61 tatcttttaa
ttactatttt tgtattaata ataaattcca ataatatttt tattcaatga
121 atattaatag
aatttggtac aatcattaga attagattaa ttaatattaa atccacaaat
181 aaaaccccaa
gattaattta ttattcagta tcagtaattt caagaatttt tttattcttt
241 ataattattg
tatacttatc atccattaga tttattaaaa cagatacttt taattttata
301 gttcaaataa
tatttttttt aaaaattgga actttcccct ttcatttttg aataatttat
361 tcttatgaaa
taataaattg aaagcaaatt tttttaatat caacattaat taaatttatt
421 ccaatttata
taatagtttc aataactaaa attaattcat gaacattata ttttttaatt
481 acaaatagat
tatatatttc attttatgct aataaatttt acactctaaa aaaattacta
// |
093.
Ильясов Р.А., Петухов А.В., Поскряков А.В., Николенко А.Г. Оценка
популяционно-генетической структуры населения медоносной пчелы Среднего
и Южного Урала. Международная конференция "Пчеловодство – XXI
век". Москва. 2010. С. 55-59.
Для
изучения генетической структуры населения медоносной пчелы Среднего и
Южного Урала мы анализировали полиморфизм локуса COI-COII
митохондриальной ДНК и микросателлитных локусов ap243, 4a110, a24 и a8.
В трех локальных популяциях медоносной пчелы (бурзянская, иглинская и
юсьвенская) наблюдались следующие частоты аллей (табл.1).
Межгенный локуса COI-COII мтДНК у медоносной пчелы представлен 4
состояниями, где единственный элемент Q на Урале характеризует
происхождение по материнской линии от подвидов пчел из южных регионов -
A.m.caucasica, A.m.carnica, A.m.ligustica и других. Все остальные
комбинации элементов P и Q на Урале характеризуют медоносную пчелу
подвида A.m.mellifera по материнской линии. Как показывает таблица 2,
бурзянская и юсьвенская популяции характеризуются максимальным
содержанием пчел, происходящих от A.m.mellifera по материнской линии.
Уровень гетерозиготности является одним из основных показателей в
популяционногенетическом анализе пчел, характеризующий величину
биологического и генного разнообразия. Для популяции медоносной пчелы
известно, что избыточная и недостаточная гетерозиготность ведет к
неблагоприятным явлениям. Для популяции медоносной пчелы в норме, по
результатам наших многолетних исследований в России, свойственен
небольшой дефицит гетерозигот (Ильясов с соавт., 2008).
Мы рассчитали величину средней наблюдаемой гетерозиготности внутри
субпопуляции HO (табл. 1) и сравнили ее со средней ожидаемой
гетерозиготностью внутри субпопуляции. Во всей популяции по всем
микросателлитным локусам ядерной ДНК наблюдается дефицит гетерозигот.
Гетерозиготность внутри субпопуляций Н больше гетерозиготности между
субпопуляциями DST. Величина межпопуляционной генетической
дифференциации GST для всей популяции небольшая и приближается к 0,1.
Показатели гетерозиготности (табл. 3) для каждой локальной популяции
также
различались. Наибольший дефицит гетерозигот наблюдался в иглинской
локальной популяции, а наименьший - в бурзянской. Межпопуляционная
составляющая гетерозиготности DST наименьшая в бурзянской локальной
популяции, а наибольшая - в иглинской. Соответственно, наименьшая
величина межпопуляционной генетической дифференциации GST наблюдается в
бурзянской локальной популяции, а наибольшая - в иглинской.
На основе изучения полиморфизма 4 микросателлитных локусов были
рассчитаны коэффициенты инбридинга F-статистики для всей популяции
(табл. 4). Расчет индекса фиксации (Wright, 1965) FiS, отражающего
инбридинг особи относительно субпопуляции показал, что во всей
популяции наблюдается дефицит гетерозигот. Индекс фиксации FiT,
отражающий инбридинг особи относительно всей общей популяции, также
показал дефицит гетерозигот во всей популяции, но на более высоком
уровне. Индекс фиксации FST, отражающий инбридинг между субпопуляциями
относительно всей целой популяции, а также уровень дифференцированности
популяции показал, что популяция в целом подразделена на субпопуляции.
Индексы фиксации, рассчитанные для субпопуляций были следующие (табл.
5). По значениям FST наименее подразделенной оказалась бурзянская
популяция, а наиболее подразделенной иглинская. Наибольший уровень
инбридинга и дефицит гетерозигот на уровне субпопуляций FiS и на уровне
всей популяции FiT наблюдался в бурзянской популяции, а наименьший - в
юсьвенской популяции. В иглинской популяции наблюдался аутбридинг с
избытком гетерозигот.
На основе стандартных генетических расстояний (Nei, 1978) по данным
анализа полиморфизма локуса COI-COII митохондриальной ДНК и
микросателлитных локусов ap243, 4a110, a24 и a8 была построена
дендрограмма (рис. 1) с использованием кластерного анализа методом
ближайшего соседа, используя в качестве меры связи метод Варда, а меры
расстояния - Евклидову дистанцию. На дендрограмме наблюдается
распределение локальных популяций на два кластера, где максимально
гибридизованная иглинская популяция группируется отдельно от двух
других. Сходная картина распределения локальных популяций наблюдается и
в случае анализа только микросателлитных локусов ядерной ДНК.
Проведенный нами анализ генетической структуры трех удаленных друг от
друга локальных популяций медоносной пчелы Южного и Среднего Урала
показал их генетическую дифференциацию и подразделенность на
субпопуляции в целом. Отмечалась совместная группировка юсьвенской
популяции медоносной пчелы с бурзянской, которая ранее была определена
на основе генетических исследований как популяция среднерусской пчелы
Apis mellifera mellifera. Это свидетельствует о происхождении
юсьвенской локальной популяции медоносной пчелы по ядерной и
митохондриальной ДНК от подвида A.m.mellifera. Ранее определенная на
основе генетических исследований гибридная иглинская локальная
популяция медоносной пчелы в данном исследовании располагалась
отдельно. Следует отметить характерный для большинства популяций
медоносной пчелы на Урале небольшой дефицит гетерозигот и инбридинг.
Гибридная иглинская популяция, наоборот, характеризуется избытком
гетерозигот и аутбридингом. Таким образом, на Южном (Бурзянский район
республики Башкортостан) и Среднем Урале (Юсьвенский район
Коми-Пермяцкого округа Пермского края) еще сохранились локальные
популяции медоносной пчелы подвида A.m.mellifera с достаточными для
длительного существования популяции во времени величиной ареала и
численности.
To study the genetic structure of the honey bee population of the
Middle and South Urals, we analyzed the polymorphism locus COI-COII
mitochondrial DNA and microsatellite loci ap243, 4a110, a24 and a8. The
three local populations of the honey bee (Burzyan, Iglinskiy and
yusvenskaya) observed the following frequencies alleys (Table 1).
Intergenic locus COI-COII mtDNA in honeybee represented 4 states, where
Q is the only element in the Urals describes the origin of the maternal
line of the sub-species of bees from southern regions - Amcaucasica,
Amcarnica, Amligustica and others. All other combinations of elements P
and Q in the Urals characterize the honeybee subspecies Ammellifera
through the maternal line. As shown in Table 2, and Burzyan yusvenskaya
populations are characterized by the highest content of bees
originating from Ammellifera through the maternal line.
The level of heterozygosity is one of the main indicators in the
analysis populyatsionnogeneticheskom bees characterizing the magnitude
of the biological and genetic diversity. For the honeybee population is
known that excessive and insufficient heterozygosity lead to adverse
events. For the honeybee population is normal, according to the results
of our many years of research in Russia peculiar small deficit of
heterozygotes (Ilyasov et al., 2008).
We have calculated the value of the average observed heterozygosity in
a subpopulation of HO (Table. 1) and compared it with the average
expected heterozygosity in a subpopulation. In the entire population of
all the nuclear DNA microsatellite loci deficient heterozygotes.
Heterozygosity in subpopulations N greater heterozygosity between
subpopulations DST. The value of inter-population genetic
differentiation GST for the entire population of a small and close to
0.1.
Indicators of heterozygosity (Table. 3) for each of the local
population and
different. The largest deficit was observed in heterozygotes Iglinsky
local population, and the lowest - in Burzyan. Interpopulation DST
smallest component of heterozygosity in Burzyan local population, and
the largest - in Iglinsky. Accordingly, the minimum value of the
inter-population genetic differentiation is observed in the GST Burzyan
local population, and the largest - in Iglinsky.
Based on the study of polymorphism of 4 microsatellite loci were
calculated inbreeding coefficients F-statistic for the entire
population (tab. 4). Calculation of the index of fixation (Wright,
1965) FiS, reflecting individual inbreeding relatively subpopulation
showed that in the general population there is a deficit of
heterozygotes. Index fixing FiT, reflecting inbreeding individuals
relative to the whole general population, also showed a deficit of
heterozygotes in the general population, but at a higher level. Index
fixing FST, reflecting inbreeding among subpopulations relative to the
entire population of the whole, and the level of differentiation of the
population showed that the population as a whole is subdivided into
subpopulations.
Fixation index calculated for subpopulations were as follows (Table.
5). At least FST values was subdivided Burzyan population, most
subdivided Iglinskiy. The highest level of inbreeding and a lack of
heterozygotes at subpopulations FiS at the level of the entire
population FiT Burzyan observed in the population, and the lowest - in
yusvenskoy population. In Iglinsky outbreeding populations observed
excess of heterozygotes.
Based on standard genetic distances (Nei, 1978) according to an
analysis of polymorphism locus COI-COII mitochondrial DNA and
microsatellite loci ap243, 4a110, a24 and a8 dendrogram was constructed
(Fig. 1) using the cluster analysis method of the nearest neighbor
using as measures Ward's method of communication, and measures the
distance - Euclidean distance. In the dendrogram observed distribution
of local populations into two clusters, where the most hybridized
Iglinskiy population is grouped separately from the other two. A
similar pattern of distribution of local populations observed in the
case of the analysis of only the nuclear DNA microsatellite loci.
Our analysis of the genetic structure of three widely separated local
populations of the honey bee South and Middle Urals demonstrated their
genetic differentiation and division into sub-population as a whole.
There was a joint group yusvenskoy honeybee population with Burzyan,
which was previously determined on the basis of genetic research as the
population of Central bee Apis mellifera mellifera. This indicates the
origin of the local population yusvenskoy honeybee on nuclear and
mitochondrial DNA from the subspecies Ammellifera. Previously defined
on the basis of genetic studies hybrid Iglinskiy local honeybee
population in this study has a separate. It should be noted
characteristic of the majority populations of the honey bee in the
Urals small deficit of heterozygotes and inbreeding. Hybrid Iglinskiy
population, by contrast, is characterized by an excess of heterozygotes
and outbreeding. Thus, in the South (Burzyan district of Bashkortostan)
and the Middle Urals (Yusvensky region of Komi-Perm district of the
Perm region) is still preserved local populations of the honey bee
subspecies Ammellifera with enough for a long time the existence of a
population the size of the area and population. |
092.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Проблемы пчеловодства
Республики Башкортостан. Материалы международной научно-практической
конференции "Биологические ресурсы". Киров. 2010. С. 73-75.
ПРОБЛЕМЫ ПЧЕЛОВОДСТВА
РЕСПУБЛИКИ БАШКОРТОСТАН Р.А.Ильясов, А.В.Поскряков, А.Г.Николенко
Институт биохимии
и
генетики Уфимского научного центра РАН 450054, Россия, Башкортостан, г.
Уфа, Пр. Октября, 71 e-mail: apismell@hotmail.com
В животноводстве
одним
из эффективных способов повышения жизнеспособности и продуктивности
сельскохозяйственных животных служит скрещивание географически и
экологически отдаленных подвидов. При этом получают гетерозисные
гибриды, которые по хозяйственным признакам значительно превосходит
своих родителей. Этим пользуются и в пчеловодстве, когда продуктивность
гибридных пчел выше, чем чистопородных, на 20-40% что отражено в
работах А.Ф. Губина (1936), В.В. Алпатова (1945) и М.И. Доморацкого
(1948). Такое мнение в свое время дало основание говорить о
необходимости внедрения в производство гибридных пчел первого поколения.
Первые плановые
работы
по качественному улучшению башкирских пчел относились к 1931 году,
когда на базе 80 колхозных пасек лесостепной зоны Башкирская зональная
опытная станция пчеловодства занялась созданием племенных пасек по
разведению пчел среднерусской расы (Дулькин с соавт., 1953, 1959). В
эти же годы в Республике Башкортостан приступили к сравнительному
испытанию различных подвидов пчел и их гибридизации. По данным Г.А.
Аветисяна (1935), гибриды первого поколения местных пчел Apis mellifera
mellifera L. с южными подвидами в Республике Башкортостан оказались
продуктивнее местных на 49%. А.Ф. Рахимкулов (1960) сообщает, что в
условиях среднего медосбора с полевых и лесных медоносов
Благовещенского района РБ гибридные пчелы давали на 20-30 кг меда
больше, чем местные. А.Н. Биктимиров (1963), наблюдая за работой
кавказских пчел Республике Башкортостан в период с 1958 по 1962 год,
отметил, что при медосборе с луговых и полевых медоносов гибридные
пчелы по продуктивности превосходили местных на 80%, но по
зимостойкости уступали последним.
В результате
многолетних
(1965-1974) опытов по испытанию завозных южных подвидов (кавказские,
карпатские, итальянские) пчел и их гибридов в Республике Башкортостан
исследователями В.Н. Власовым и Г.К. Косаревым (1980) установлено, что
имеются определенные различия в летной и медособирательной работе,
развитии и продуктивности семей в зависимости от медосборных условий по
природным зонам. Так, в лесостепной и степной зонах гибридные
кавказские и итальянские пчелы по нагрузке медового зобика и общему
приносу нектара достоверно превышали пчел местного подвида, тогда как
при медосборе с липы превосходство наблюдалось у местных пчел
среднерусской расы Apis mellifera mellifera. В дальнейшем, в ходе
разработки плана породного районирования медоносных пчел СССР в
условиях республики Башкортостан проводили сравнительные испытания
местных пчел, пчел южных рас и их гибридов (Биктимиров, 1963;
Джапаридзе, 1988). В основу данной работы по сравнительной оценке
использования рас пчел была положена методика, разработанная
научно-исследовательским институтом
пчеловодства
(Билаш,
1963). Первый этап испытаний (1965-1968) проводился в Казангуловском
опытном хозяйстве Давлекановского района и в колхозе им. Куйбышева
Альшеевского района (1967-1968). На втором этапе (1970-1972) испытывали
перспективные для степного взятка семьи пчел - гибридов первого
поколения (местных с серыми горными кавказскими).
В 1965-1970гг. на
Башкирской опытной станции пчеловодства (БОСП) проводились породные
испытания гибридов от скрещивания итальянских пчел с местными. По
результатам наблюдений они собрали меда на 51% больше, чем местные
среднерусские, но последующие поколения гибридов, по сравнению с
родительскими особями, не давали положительных результатов. А. А. Юрьев
же (1969) отмечал, что привезенные с Кавказа на Урал пчелы по медо- и
воскопродуктивности не превосходили местных и уступали им по
зимостойкости .
Однако позже
стало
известно, что гетерозис проявляется не при любых скрещиваниях пчел и
зависит от направления скрещивания (Жданов, 1970; Бородачев и
Бородачева, 1982). Уменьшение жизнеспособности и
продуктивности
гибридных
пчел является результатом гибридного дисгенеза. Бесконтрольная
гибридизация пчел среднерусской расы с южными, чувствительными к низким
температурам, подвидами пчел является одной из основных причин гибели и
ослабления пчелиных семей в зимне-весенний период и одной из важнейших
проблем пчеловодства (Черевко, Черевко, 1998). За последние двадцать
лет в республике Башкортостан почти ежегодно принимались программы по
сохранению башкирской пчелы Apis mellifera mellifera. Однако генофонд
башкирской пчелы продолжал находиться в состоянии глубокой
гибридизации. Ежегодно в республике Башкортостан погибало не менее
8-10% всех семей, т.е. около 15-20 тысяч (Косарев, 1989).
Скоро неудачный
эксперимент по массовому улучшению аборигенных подвидов пчел был
прерван. В 1958 году организован Прибельский филиал Башкирского
заповедника по сохранению аборигенных бортевых пчел (Тахаев, 1959). В
1986 г. он был преобразован в самостоятельный заповедник
«Шульган- Таш». Заповедник расположен на юге
Республики
Башкортостан в пределах Бурзянского административного района, и по
своему географическому положению относится к Центральному горному
району Южного Урала. Заповедник находится в западной части данного
района, имеет сложную вытянутую конфигурацию границ, расположен между
реками Белая и Нугуш в пределах 5300Г-53015’ с.ш. и
56053,-57007’ в.д. Протяженность территории с севера на юг
составляет 26 км, с запада на восток - 15 км, а общая площадь
составляет 22531 га.
В 1959 г. в
России были
приняты меры по охране A.m.mellifera. По решению Технического совета
Министерства сельского хозяйства РСФСР от 20 октября 1959 году была
запрещена интродукция пчел из южных районов в северные - Сибирь и Урал.
В 1974-1983 годы БОСП занималась проблемой массовой репродукции маток.
Ими были разработаны технологии репродукции маток, которые испытывались
в 10 хозяйствах республики, а также созданы 4 специализированные пасеки
в крупных пчелосовхозах с объемом воспроизводства 28-32 тыс.
чистопородных неоплодотворенных маток за сезон.
Также за период с
1981
по 1985 гг. БОСП были проведены экспедиции по территории Республики
Башкортостан с целью поиска и завоза лучших семей башкирской популяции
среднерусской расы на территорию Иглинского района для создания
племенных пасек. За этот период на станцию было завезено более 200
семей, организованы 2 племенные пасеки и начаты работы по аналитической
селекции (Газизов, 1987).
Сохранению
бортевых
пчелиных семей в условиях Бурзянского района благоприятствовали
климатические условия и хорошая естественная кормовая база - большие
массивы липы, клена, ивы и разнообразная травянистая медоносная
растительность. Бурзянский район является одним из самых отдаленных и
изолированных в Республике Башкортостан. Долгое время туда практически
не было проложено хороших дорог и этот район до сих пор остается самым
малозаселенным в Республике. Его изоляции способствует также
расположение в горно-лесной зоне Южного Урала. В гористой местности
Бурзянского района конец цветения одного растения на южном склоне
совпадает с началом цветения на северном склоне. На протяжении 200-210
дней суровой зимы с морозами, нередко достигающими 45°С, семьи
чувствуют себя нормально, весной в них бывает небольшое количество
подмора. Бортевые пчелы меньше страдают от пади в зимних кормах по
сравнению с пчелами, которые находятся в зимовниках. Очистительный
облет весной они делают раньше и при более низкой температуре (Шакиров,
1992; Власов, 1996).
В период
2000-2009 гг.
наша лаборатория в составе института биохимии и генетики Уфимского
научного центра РАН проводила молекулярногенетические исследования
медоносной пчелы в республике Башкортостан. В основу метода
исследования был заложен полиморфизм микросателлитных локусов ядерной
ДНК и некоторых локусов мтДНК (Ильясов с соавт., 2007). Мы показали,
что на территории республики Башкортостан еще сохранилось несколько
больших массивов населения медоносной пчелы среднерусской расы Apis
mellifera mellifera. На данный момент один из них занимает обширную
северную область республики, другой - горную юго-восточную область
республики Башкортостан. Следует отметить, что население пчел северной
области значительно превосходит по распространенности население пчел
юговосточной горной области. Кроме того, имеется очень прерывистый
ареал Apis mellifera mellifera в центральных и западных областях
республики Башкортостан. С большой уверенностью можно сказать, что
население пчел юго-восточной горной области относится к популяционной
системе, тогда как население пчел других областей - к метапопуляции.
Таким образом, республика Башкортостан на современном этапе развития
обладает мощным резервным потенциалом для восстановления популяции
аборигенных среднерусских пчел в ареалах, разорванных процессом
гибридизации как на собственной территории, так и территории других
северных регионов.
BEE PROBLEMS
BASHKORTOSTAN R.A.Ilyasov, A.V.Poskryakov, A.G.Nikolenko
Institute of
Biochemistry and Genetics, Ufa Scientific Center, RAS 450054, Russia,
Bashkortostan, Ufa, pr. Oct. 71 e-mail: apismell@hotmail.com
In animal an
effective
way to improve the viability and productivity of farm animals is a
crossing of geographically remote and environmentally subspecies. This
produces heterosis hybrids that on economic grounds far exceeds their
parents. This is used in beekeeping when the productivity of hybrid bee
higher than pure-bred, by 20-40%, which is reflected in the works of AF
Gubin (1936), VV Alpatov (1945) and MI Domoratskogo (1948). Such an
opinion at the time gave reason to talk about the need to introduce in
the production of hybrid of the first generation of bees.
The first plan of
work
for the qualitative improvement of the Bashkir bees belonged to 1931,
when on the basis of collective 80 apiaries steppe zone Bashkir zonal
experimental station of beekeeping engaged in the creation of breeding
apiaries for breeding bees of Central Race (Dulkin et al., 1953, 1959).
In the same years in the Republic of Bashkortostan started to
comparative tests of different subspecies of bees and their
hybridization. According to GA Avetisyan (1935), the first generation
hybrids local bee Apis mellifera mellifera L. from southern subspecies
in the Republic of Bashkortostan have been productive local 49%. AF
Rakhimkulov (1960) reports that in the average honey yield from field
and forest honey plants Annunciation district RB hybrid bees gave 20-30
kg of honey more than local. AN Biktimirov (1963), observing the work
of the Caucasian bees Republic of Bashkortostan in the period from 1958
to 1962, noted that the honey harvest with meadow and field hybrid bee
honey plants on the productivity of local superior for 80%, but
conceded last winter hardiness.
As a result of
long-term
(1965-1974) experiments on testing imported southern subspecies
(Caucasus, Carpathian, Italian) of bees and their hybrids in the
Republic of Bashkortostan researchers VN Vlasov and GK Kosarev (1980)
found that there are certain differences in summer and medosobiratelnoy
work, development and productivity of families depending on medosbornyh
conditions of natural areas. Thus, in the forest-steppe and steppe
zones of hybrid Caucasian and Italian bees on honey zobika load and
brings the total of nectar bees significantly exceed the local
subspecies, whereas with linden honey yield superiority was observed in
native bees of Central race Apis mellifera mellifera. Later, during the
development of the breed regionalization plan honeybees USSR in the
Republic of Bashkortostan conducted comparative tests of native bees,
bees southern races and their hybrids (Biktimirov, 1963; Japaridze,
1988). This paper is based on the comparative assessment of the races
of bees were based on a procedure developed by a research institute
Beekeeping
(Bilash,
1963). The first stage of testing (1965-1968) was held in
Kazangulovskom Davlekanovskiy experimental farm area and the farm to
them. Alsheevsky Kuibyshev district (1967-1968). In the second phase
(1970-1972) experienced perspective to bribe steppe family of bees -
the first generation hybrids (local gray mountain Caucasian).
In 1965-1970gg.
Bashkir
Bee Research Station (VSDB) tests were conducted breed hybrids by
crossing Italian bees with the locals. According to the results of
observations of honey they collected 51% more than the local Central
Russian, but the next generation of hybrids compared with parental
individuals, did not give positive results. A. Yuryev same (1969) noted
that imported from the Caucasus to the Ural bee on medo-
voskoproduktivnosti and do not exceed local and inferior to them in
winter hardiness.
However, later it
became
known that heterosis is manifested not in any crosses bees and depends
on the direction crossing (Zhdanov, 1970; bearded Borodacheva, 1982).
Reducing the viability and
productivity is a
result
of hybrid bees hybrid dysgenesis. Uncontrolled hybridization bees of
Central race with southern sensitive to low temperatures, bee
subspecies is one of the major causes of death and the weakening of bee
colonies in winter and spring, and one of the major problems of
beekeeping (Cherevko, Cherevko, 1998). Over the past twenty years in
the Republic of Bashkortostan adopted almost every year of the program
for the conservation of Bashkir bee Apis mellifera mellifera. However,
the gene pool of the Bashkir bee continued to be in a state of deep
hybridization. Every year in the republic of Bashkortostan perished at
least 8-10% of all families, ie 15-20 thousand (Kosarev, 1989).
Soon the failed
experiment of massive improvement subspecies native bees was
interrupted. In 1958 he organized a branch of the Bashkir Pribelsky
reserve on conservation of native wild-hive bee (Taha 1959). In 1986 it
was transformed into an independent reserve "Shulgan- Tash." The
reserve is located in the south of the Republic of Bashkortostan within
Burzyansky Administrative Region, and its geographical location refers
to the central highlands of the Southern Urals. The reserve is located
in the western part of the region, it has a complex configuration of
the extended boundaries, located between the rivers White and Nugush
within 5300G-53015 'N and 56053, -57007 'E. The length of the territory
from north to south is 26 km, from west to east - 15 km and a total
area of 22531 hectares.
In 1959, Russia
adopted
measures to protect Ammellifera. According to the decision of the
Technical Council of the Ministry of Agriculture of the Russian
Federation dated 20 October 1959, prohibited the introduction of bees
from southern to northern - Siberia and the Urals. In 1974-1983 years
he worked VSDB problem of mass reproduction of queens. They have
developed technology of reproduction of queens, which were tested in 10
farms of the republic, as well as create 4 specialized in large apiary
pchelosovhozah with a volume of 28-32 thousand reproduction. Infertile
thoroughbred mares per season.
Also, for the
period
from 1981 to 1985. VSDB expeditions were conducted on the territory of
the Republic of Bashkortostan for the purpose of search and delivery of
the best families of the Bashkir population of the territory of Central
race iglinsky district to create a breeding apiaries. During this
period, the station was brought more than 200 families, organized two
tribal apiary and started work on analytical selection (Gazizov, 1987).
Conservation of
wild-hive bee colonies under Burzyansky district favored climatic
conditions and good natural food supply - large amounts of lime, maple,
willow and diverse herbaceous vegetation honey. Burzyan area is one of
the most remote and isolated in the Republic of Bashkortostan. For a
long time there was virtually no good roads paved and the area still
remains the most sparsely populated in the country. It also contributes
to the isolation location in the mountain forest zone of Southern
Urals. In mountainous terrain Burzyansky district end of flowering
plants on the southern slope coincides with the beginning of flowering
on the northern slope. For 200-210 days of severe winter frosts, often
reaching 45 ° C, the family feel good spring in them is a small
amount of Podmore. Wild-hive bee suffer less from winter fodder paddy
compared to bees that are in Zimovniki. Cleansing circled the spring
before they do, and at a lower temperature (Shakirov, 1992; Vlasov,
1996).
In the period
2000-2009.
our laboratory in the Institute of Biochemistry and Genetics, Ufa
Scientific Center, Russian Academy of Sciences conducted research
molekulyarnogeneticheskie honeybee in the Republic of Bashkortostan.
The basis of the research method was laid polymorphism of
microsatellite loci of nuclear DNA and mtDNA of some loci (Ilyasov et
al., 2007). We have shown that in the territory of the Republic of
Bashkortostan has survived several large arrays of honeybee populations
of Central race Apis mellifera mellifera. At the moment, one of them is
a vast northern region of the republic, the other - a mountain
south-eastern area of the Republic of Bashkortostan. It should be
noted that the population of bees the northern region is significantly
superior to the prevalence of the population of bees southeastern
mountain region. In addition, there is a very intermittent area Apis
mellifera mellifera in the central and western regions of the Republic
of Bashkortostan. With great confidence we can say that the bee
population of the southeastern mountain region refers to the system of
population, whereas the population of bees other areas - a
metapopulation. Thus, the Republic of Bashkortostan at the present
stage of development has a powerful backup capabilities for restoring
populations of native bees in Central Russia resorts, broken
hybridization process on its own territory, and in other northern
regions. |
091.
Ильясов Р.А., Фахретдинова С.А., Поскряков А.В., Николенко А.Г.
Генетическая структура бурзянской популяции медоносной пчелы Apis
mellifera mellifera L. Материалы I международных Беккеровских чтений.
Волгоград. 2010. С. 46-50.
Медоносная
пчела подвида Apis mellifera mellifera L. является аборигенной для
республики Башкортостан. Наиболее известная популяция медоносной пчелы
этого подвида - бурзянская, характеризующаяся наличием большого числа
бортевых семей. Для сохранения этой пчелы необходима разметка границ ее
ареала. В данной работе мы на основе анализа межгенного локуса COI-COII
мтДНК, локуса ND2 мтДНК и микросателлитных локусов ap243, 4a110, ap049,
a24 ядерной ДНК показали, что популяция до сих пор сохранилась
чистопородной, а ее границы, возможно, распространятся за пределы
административных границ района на север в сторону Белорецкого района и
на юг в сторону Зилаирского района республики Башкортостан. Для
бурзянской популяции медоносной пчелы характерен небольшой уровень
инбридинга.
Honeybee
subspecies Apis
mellifera mellifera L. is a native of the Republic of Bashkortostan.
The best known of the honey bee population of this subspecies - Burzyan
characterized by the presence of a large number of family tree hollow.
To save the bees need this marking the boundaries of its range. In this
paper, we based on the analysis of intergenic locus COI-COII mtDNA
locus ND2 mtDNA and microsatellite loci ap243, 4a110, ap049, a24
nuclear DNA showed that the population is still kept purebred and its
boundaries may spread beyond administrative boundaries district north
towards the Beloretsk area and south towards Zilair district of
Bashkortostan. For Burzyan honeybee populations typical small level of
inbreeding. |
090.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Генное разнообразие и
коэффициенты инбридинга медоносной пчелы в локальной популяции на
севере Республики Башкортостан. Материалы всероссийской
научно-практической конференции "Полевые и экспериментальные
исследования биологических систем". Ишим. 2010. C.66-68.
Нами
были
изучены пчелы с 42 пасек трех северных районов (Бирский, Караидельский,
Мишкинский). Всего было проанализировано по микросателлитным локусам
ар243, 4а110 и А8 ядерной ДНК пчел из 211 семей исследуемых районов
Республики Башкортостан. В изучаемой выборке пчел нами были рассчитаны
F-коэффициенты и гетерозиготность. Использование в анализе
F-коэффициентов и гетерозиготностей позволяет наиболее полноценно и
всесторонне охарактеризовать популяции и сравнивать их с аналогичными
показателями других популяций. Кроме того, эти характеристики позволяют
говорить о процессах, происходящих в популяции и прогнозировать
дальнейшую динамику популяции. Анализ средних значений последних по
микросателлитным локусам ap243, 4a110 и А8 ядерной ДНК (Табл. 1)
показал, что популяция северного ареала башкирской пчелы
характеризуется низким уровнем генетической дифференциации (FST=0,015)
между субпопуляциями, что свидетельствует о возможном единстве
происхождения пчел из этих популяций.
Близкие к нулю значения коэффициентов инбридинга (FIS=0,122 и
FIT=0,135) и близкие значения наблюдаемой (HО=0,435) и ожидаемых
(HS=0,485 и HТ=0,493) показателей гетерозиготности отражают баланс
между инбридингом и аутбридингом, как в отдельных субпопуляциях, так и
во всей популяции, в целом, а также свидетельствуют о том, что
распределение генотипов по всем локусам приближается к равновесному по
Харди-Вайнбергу. Такое равновесное состояние дает возможность
длительного существования популяции в современных неизменных условиях
окружающей среды.
Таким образом, популяция северного ареала башкирской пчелы
A.m.mellifera характеризуется отсутствием подразделенности между
населениями пчел Бирского, Караидельского и Мишкинского районов.
Минимальное отклонение от равновесия Харди-Вайнберга свидетельствует об
устойчивости популяции во времени и незначительном влиянии на нее
факторов эволюции. Наблюдаемые коэффициенты инбридинга в популяции
можно принять за оптимальные равновесные значения, которые сложились в
течение продолжительного времени становления северной популяции
A.m.mellifera, которые можно использовать в сравнении с другими
популяциями.
We have studied bees with 42 apiaries three northern regions (Birsky,
Karaidelsky, Mishkinskoye). There were analyzed for microsatellite loci
ar243, 4a110 and A8 nuclear DNA of 211 families of bees studied areas
of the Republic of Bashkortostan. In our sample of bees we calculated
F-ratios and heterozygosity. Using the analysis of F-ratios and
heterozygous allows most fully and comprehensively characterize the
population, and to compare them with those of other populations. In
addition, these characteristics allow us to speak about the processes
occurring in the population and to predict the future dynamics of the
population. Analysis of the average of the last of microsatellite loci
ap243, 4a110 A8 and nuclear DNA (Table. 1) showed that the population
of the northern area of the Bashkir bee is characterized by a low
level of genetic differentiation (FST = 0,015) between subpopulations,
suggesting a possible common origin of these populations of bees .
Near-zero coefficient of inbreeding (FIS = 0,122 and FIT = 0,135) and
similar values observed (HO = 0.435) and expected (HS = 0,485 and HT
= 0.493) heterozygosity indices reflect a balance between inbreeding
and outbreeding, in certain subpopulations, as and in the population as
a whole, as well as evidence that the distribution of genotypes at all
loci close to the equilibrium of Hardy-Weinberg equilibrium. This
equilibrium state allows continued existence of the population in
modern constant environmental conditions.
Thus, the population of the northern area of the Bashkir bee
Ammellifera characterized by lack of division between the population of
bees Birsk, Karaidelskogo and Mishkinsky areas. Minimum deviation from
Hardy-Weinberg equilibrium demonstrates the stability of the population
in time and insignificant effect on her evolutionary factors. The
observed rates of inbreeding in the population can be taken for optimal
equilibrium values that have been established for a long time the
formation of northern populations Ammellifera, which can be used in
comparison with other populations. |
089.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Молекулярная
характеристика населения медоносной пчелы центральной части республики
Башкортостан на основе анализа микросателлитных локусов //
Экологический мониторинг и биоразнообразие. Т.5. №1. 2010. C 65-68.
В работе нами
были
проанализированы медоносные пчелы из 32 семей Иглинского района (3
пасеки: с.Улу-Теляк, пасека Кугейко; с.Улу-Теляк, пасека Громова;
с.Улу-Теляк, БОСП, пасека матковыводная), 17 семей Альшеевского района
(3 пасеки: с.Никифарово, пасека Юсуповой Р.; с.Раевка, пасека Пискарева
М.П.; с.Раевка, пасека Селезнева Б.), 51 семьи Бирского района (10
пасек: д. Угузево, пасека Сафина А.Ф.; г.Бирск, пасека Черенкова В.С.;
г.Бирск, пасека Сайфутдинова Е.В.; д.Осиновка, пасека Черникова Ю.П.;
д.Акуди, пасека Яикбаева А.А.; д.Печенкино, пасека Габитова И.Р.;
д.Улеево, пасека Янситова В.В.; д.Кондаковка, пасека Акмурзина Е.Н.;
д.Вязовка, пасека Лепустина И.А.; д.Бахтыбаево, пасека Кутлусатова
М.П.), собранные в период 2004-2008 гг. Всего нами были
проанализированы медоносные пчелы из 100 семей пчел трех районов
центральной части республики Башкортостан (Иглинский, Альшеевский и
Бирский). В популяционном анализе были использованы 4 микросателлитных
локуса Ap243, 4a110, A24, A8 (Estoup et al., 1995; Solignac et al.
2003). По наблюдаемой частоте аллелей были рассчитаны генетические
расстояния Cavalli-Sforza, Edwards (1967) (Табл. 1) и построена
дендрограмма (Рис. 1). Население медоносной пчелы Альшеевского района
на дендрограмме располагается отдаленно от двух других популяций, что
свидетельствует о преобладании потока генов между населениями
медоносной пчелы Иглинского и Бирского районов над потоком между каждым
из вышеназванных населений и населением Альшеевского района. Население
медоносной пчелы Иглинского и Бирского районов ранее по
митохондриальной ДНК были отнесены к гибридным и среднерусским
A.m.mellifera, соответственно, и их совместная группировка произошла
благодаря вкладу северной популяции башкирской медоносной пчелы в
создание населения пчел Иглинского района. Кроме того, произошедший
завоз семей пчел из гибридизованных пасек Иглинского района в Бирский
район также мог привести их к генетическому сближению.
По значениям
коэффициентов инбридинга Fis, Fit (Табл. 2) в населении медоносной
пчелы центральной части республики Башкортостан отмечается преобладание
близкородственного скрещивания над отдаленным. А значение коэффициента
инбридинга Fst показывает об отсутствии подразделенности –
это
говорит о высоком уровне миграции населения медоносной пчелы
центральной части республики Башкортостан.
Таким образом,
население
медоносной пчелы центральной части республики Башкортостан
характеризуется отсутствием определенной генетической
структурированности, преобладанием инбридинга над аутбридингом. Поток
генов между населениями медоносной пчелы увеличивается с уменьшением
расстояния между ними. Генетическое родство населений медоносной пчелы
разных районов обусловлено миграцией семей между ними. Характеристики
F-статистики свидетельствуют о максимальном приближении населения
медоносной пчелы центральной части республики Башкортостан в целом к
равновесному состоянию и о небольшом снижении устойчивости генофонда к
внешним воздействиям.
In this paper we
analyzed honeybees from 32 families iglinsky district (3 apiary:
s.Ulu-Telyak, apiary Kugeiko; s.Ulu-Telyak, apiary Gromov;
s.Ulu-Telyak, VSDB, apiary matkovyvodnaya), 17 families Alsheevsky area
(3 apiary: s.Nikifarovo, P .; apiary Yusupova s.Raevka, apiary
Piskareva MP .; s.Raevka, apiary Seleznev BI), 51 family Birsk area (10
apiaries: d. Uguzevo, apiary Safina A. F .; g.Birsk, apiary VS
Cherenkov .; g.Birsk, apiary Sayfutdinova EV .; d.Osinovka, apiary
Chernikov YP .; d.Akudi, apiary Yaikbaeva AA d.Pechenkino .; , apiary
Gabitova I.R .; d.Uleevo, apiary Yansitova VV .; d.Kondakovka, apiary
Akmurzina EH .; d.Vyazovka, apiary Lepustina IA .; d.Bahtybaevo, apiary
Kutlusatova MP .) collected in 2004-2008. In total we analyzed honey
bees from 100 bee colonies in the three districts of the central part
of the republic of Bashkortostan (Iglinskiy, Alsheevsky and Birsky).
The population analysis were used 4 microsatellite loci Ap243, 4a110,
A24, A8 (Estoup et al., 1995; Solignac et al. 2003). According to the
observed allele frequencies were calculated genetic distances
Cavalli-Sforza, Edwards (1967) (Table. 1) and is constructed dendrogram
(Fig. 1). The population of the honeybee Alsheevsky area on the
dendrogram is distant from the other two populations, indicating that
the prevalence of gene flow between the populations of the honey bee
and Iglinskiy Birsk areas over the flow between each of the above
populations and populations Alsheevsky area. The population of the
honeybee and Iglinskiy Birsk areas earlier on mitochondrial DNA have
been attributed to hybrid and Srednerussky Ammellifera, respectively,
and the joint group was due to the contribution of the northern
population of the Bashkir honey bee population of bees in creating
iglinsky district. In addition, the delivery of which occurred bee
colonies hybridized from apiaries iglinsky district Birsk area could
also lead them to the genetic convergence.
From the values
of
coefficients of inbreeding Fis, Fit (Tab. 2) in the honey bee
population of the central part of the republic of Bashkortostan marked
predominance of inbreeding on the remote. A coefficient of inbreeding
Fst indicates the absence of division - this shows a high level of
migration of the honey bee population of the central part of the
republic of Bashkortostan.
Thus, the honey
bee
population of the central part of the Republic of Bashkortostan is
characterized by the absence of certain genetic structuring, the
prevalence of inbreeding outbreeding. Gene flow between the populations
of the honey bee increases with decreasing distance between them.
Genetic relatedness honeybee populations of different areas due to
migration between the two families. Features F-statistics show extreme
close honey bee population of the central part of the Republic of
Bashkortostan as a whole to equilibrium and a slight decrease in the
stability of the gene pool to external influences.
Microsatellite
loci is
fine tools in population researches. We analysed honey bees population
from 100 colonies of three regions of central part of Bashkortostan
republic using microsatellite loci Ap243, 4a110, A24, A8. We shown that
honey bee population have not exact structuredness. F-statistics shown
little prevalence inbreeding on autbreeding. That characteristics
witness about maximal approach to equilibrium condition.
|
088.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Эволюция и филогенетика
медоносной пчелы Урала. Материалы международной научной конференции
"Проблемы экологии. Чтения памяти профессора М.М.Кожова". Иркутск.
2010. С. 248.
Для
решения
вопросов о подвидах медоносной пчелы, биогеографии и филогенетики
наиболее удобно сравнительное изучение последовательности региона
мтДНК, охватывающего часть второй субъединицы NADH дегидрогеназы (ND2)
и тРНК изолейцина (tRNA ILE). В ходе секвенционного анализа
амплифицированного фрагмента гена ND2 мтДНК медоносной пчелы была
определена его нуклеотидная последовательность со средним размером 688
п.н. Нуклеотид-ные последовательности просеквенированных фрагментов
гена ND2 мтДНК пчел были депонированы в международный генбанк NCBI.
На дендрограмме, построенной по результатам сравнения нуклеотидных
последовательно-стей фрагмента гена ND2 не наблюдалось большой
дифференциации между представителями населений медоносной пчелы
A.m.mellifera разных регионов на Урале (Бурзянский, Татышлин-ский,
Бирский районы республики Башкортостан и Крсновишерский, Частинский,
Нытвенский и Осинский районы Премского края), что является показателем
их тесного генетического родства. Представители уральских и европейских
популяций A.m.mellifera кластеризовались в одну группу, названную
эволюционной ветвью М. Но от ветви М, предложенной F.Ruttner et al.
(1988), она отличалась тем, что в ее состав вошел только один
единственный подвид - A.m.mellifera.
Большинство представителей африканских подвидов пчел вошли во вторую
группу, названную эволюционной ветвью А, по аналогии с F.Ruttner et al.
(1988), хотя по составу подвидов наблюдались определенные различия. Эта
ветвь разделилась на две подгруппы, объединяющие северо-африканские и
южно-африканские подвиды, что сходно с группировкой M.C.Arias,
W.S.Sheppard (1996). Однако, в отличие от группировки последних
авторов, мы еще наблюдали третью африканскую группу, объединяющую пчел
Центральной Африки - Apis mellifera adansonii Latreille из Сенегала и
Apis mellifera scutellata Lepeletier из Кении. От основания ветви А
отделилась небольшая группа, куда вошли Apis mellifera meda Skorikov из
Сирии, Apis mellifera syriaca Buttel-Reepen из Сирии и Apis mellifera
lamarckii Cockerell из Египта, названная эволюционной ветвью О. В
четвертую многочисленную группу, названную эволюционной ветвью С, вошли
пчелы Средиземноморья, Ближнего Востока и Кавказа.
В дальнейшем мы планируем включить в филогенетический анализ население
медоносной пчелы Apis mellifera республик Удмуртия и Татарстан,
Свердловской и Челябинской областей.
To address questions about the honey bee subspecies, biogeography and
phylogeny most convenient comparative study of mtDNA sequences in the
region, covering part of the second subunit of NADH dehydrogenase (ND2)
and isoleucine tRNA (tRNA ILE). During sekventsionnogo analysis
amplified gene fragment ND2 mtDNA honeybee was determined its
nucleotide sequence with an average size of 688 bp Nucleotide sequences
sequenced gene fragments ND2 mtDNA bees were deposited at an
international genebank NCBI.
In the dendrogram constructed by comparing the nucleotide sequence-gene
fragment ND2 stey was no big differentiation between the populations of
the honey bee Ammellifera different regions of the Urals (Burzyan,
Tatyshlin-sky, Birsky districts of the republic of Bashkortostan and
Krsnovishersky, Chastinsky, Nytva and Osa region Premskogo Territory),
which is an indicator of their close genetic relationship. The
representatives of the Ural and European populations Ammellifera
clustered into one group called evolutionary branch from the branch M.
But M proposed F.Ruttner et al. (1988), it is different in that its
composition entered only a single subspecies - Ammellifera.
Most of the African subspecies of bees included in the second group,
called evolutionary branch A, by analogy with the F.Ruttner et al.
(1988), although the composition of certain subtypes observed
differences. This branch was divided into two subgroups, combining
North African and South African subspecies, which is similar to
grouping MCArias, WSSheppard (1996). However, unlike the latter group
of authors, we have seen a third of the African Group combining the
Central African bees - Apis mellifera adansonii Latreille from Senegal
and Apis mellifera scutellata Lepeletier from Kenya. From the base of
the branches and the Division of a small group which included Apis
mellifera meda Skorikov Syria, Apis mellifera syriaca Buttel-Reepen
from Syria and Apis mellifera lamarckii Cockerell of Egypt, called
evolutionary branch A. The fourth largest group, called evolutionary
branch C includes bees Mediterranean, the Middle East and the Caucasus.
In the future, we plan to include in the phylogenetic analysis of the
population of the honeybee Apis mellifera republics of Udmurtia and
Tatarstan, Sverdlovsk and Chelyabinsk regions.
|
087.
Салтыкова Е.С., Гайфуллина Л.Р., Ильясов Р.А., Николенко А.Г. Действие
хитозана на индукцию основных антибактериальных пептидов у медоносной
пчелы. Материалы Десятой Международной конференции "Современные
перспективы в исследовании хитина и хитозана". Нижний новгород. 2010.
С. 308-310.
Проводился
анализ изменения экспрессии антимикробных пептидов дефенсин и абецин
под влиянием подкормки сахарным сиропом с хитозаном. Было показано
увеличение уровня экспрессии генов антимикробных пептидов под влиянием
хитозана примерно в 2 раза, что свидетельствует о роли хитозана в
организме медоносной пчелы в повышении иммунитета и адаптированности к
условиям окружающей среды.
Антимикробные
пептиды (АМП) в организме медоносной пчелы играют важную роль в
иммунитете и выживаемости. Два наиболее известных из них дефензин и
абецин. Нами был проведен ПЦР в режиме реального времени по результатам
поставленного эксперимента при однократном кормлении пчел 0,001%
раствором хитозана. После кормления пчел экстрагировалась мРНК, на
основе которой синтезировалась кДНК для последующей ПЦР в режиме
реального времени (ПЦР РВ). Целью нашего эксперимента стала проверка
влияния хитозана на уровень экспрессии антимикробных пептидов абецина и
дефензина у медоносной пчелы. Ген MGST в эксперименте использовался в
качестве контроля, как ген, на экспрессию которого не должно влиять
кормление хитозаном.
Нами
были получены данные об уровне изменения экспрессии каждого
антимикробного пептида в отдельности в двух повторностях. По
результатам поставленных экспериментов после кормления пчел хитозаном
можно заключить, что уровень экспрессии дефензина имеет тенденцию к
увеличению на 142% (P=0,053) в 1 эксперименте и на 96% (P=0,033) во 2
эксперименте. Уровень экспрессии абецина увеличился на 188%
(P<0,001) в 1 эксперименте и на 100% (P<0,001) во 2
эксперименте.
Таким
образом, можно предположить, что однократное кормления пчел 0,001%
раствором хитозана приводит к заметному увеличению уровня экспрессии
антимикробных пептидов дефензина (в 2-2,8 раз) и абецина (в 1,9-2,4
раза) в организме медоносной пчелы Apis mellifera mellifera.
Analyzed
changes in the expression of antimicrobial peptides of defensin and
abetsin influenced by feeding sugar syrup with chitosan. It has been
shown to increase the level of gene expression of antimicrobial
peptides under the influence of chitosan is about 2 times, indicating
that the role of chitosan in the body of the honeybee in improving
immunity and adaptability to environmental conditions.
Antimicrobial
peptides (AMPs) in the body of the honeybee play an important role in
immunity and survival. The two most prominent of these defensin and
abetsin. We carried out the PCR in real time from the results of the
experiment with a single staged feeding of bees 0.001% solution of
chitosan. After feeding, the bees extracted mRNA from which the cDNA
was synthesized for subsequent PCR in real time (real-time PCR). The
purpose of our experiment was to check the effect of chitosan on the
level of expression of antimicrobial peptides and abetsina defensin in
the honeybee. MGST gene used in the experiment as a control as the gene
for expression of which should not affect feeding chitosan.
We
obtained data on the changes in the expression level of each of the
antimicrobial peptide separately in duplicate. According to the results
of experiments set after feeding bees chitosan it can be concluded that
the expression level of defensin tends to increase by 142% (P = 0,053)
in one experiment and by 96% (P = 0,033) in the two experiments. The
expression level of abetsina increased by 188% (P <0,001) in
experiment 1 and 100% (P <0,001) in the 2nd experiment.
Thus,
it can be assumed that a single foraging bees 0.001% chitosan solution
leads to a marked increase in the level of expression of defensin
antimicrobial peptides (in 2-2,8 times) abetsina (a 1.9-2.4-fold) in
the body of the honeybee Apis mellifera mellifera. |
086.
Ильясов Р.А., Петухов А.В., Поскряков А.В., Николенко А.Г. Популяция
медоносной пчелы Среднего и Южного Урала. Материалы VIII
Межрегионального совещания энтомологов Сибири и Дальнего Востока
"Энтомологические исследования в Северной Азии". Новосибирск. 2010. C.
91-93.
Нами
были собраны медоносные пчелы Apis mellifera из 43 семей с 2 пасек
заповедника Шульган-Таш Бурзянского района республики Башкортостан
(пасека Капова-Пещера кордон заповедника; пасека п.Коран-Елга), из 52
семей с 6 пасек Башкирской опытной станции пчеловодства Иглинского
района республики Башкортостан (п.Улу-Теляк, пасека Гареева;
п.Улу-Теляк, пасека матковыводная; п.Улу-Теляк, пасека Орловская;
п.Улу-Теляк, пасека Кугейко; п.Улу-Теляк, пасека Громова; п.Улу-Теляк,
пасека Шамсуринская), из 37 семей с 8 пасек Юсьвенского района
Коми-Премяцкого округа Пермского края (с.Архангельское, пасека
Кривощекова Д.Ф.; с.Юсьва, пасека Быкова Н.А.; с.Почашор, пасека
Сторожева В.М.; д.Федотово, пасека Власова В.Д.; д.Федорово, пасека
Бояндина А.Г.; пасека д.Б.Они; пасека д.Доег; пасека д.Пожва). Всего
было проанализировано 132 семьи медоносной пчелы.
Для изучения
генетической структуры населения медоносной пчелы Среднего и Южного
Урала мы анализировали полиморфизм локуса COI-COII митохондриальной ДНК
и микросателлитных локусов ap243, 4a110, a24 и a8. В трех локальных
популяциях медоносной пчелы (бурзянская, иглинская и юсьвенская)
наблюдались следующие частоты аллей.
Межгенный локус
COI-COII
мтДНК у медоносной пчелы представлен 4 состояниями, где единственный
элемент Q на Урале характеризует происхождение по материнской линии от
подвидов пчел из южных регионов – A.m.caucasica, A.m.carnica,
A.m.ligustica и других. Все остальные комбинации элементов P и Q на
Урале характеризуют медоносную пчелу подвида A.m.mellifera по
материнской линии. Бурзянская и юсьвенская популяции характеризуются
максимальным содержанием пчел, происходящих от A.m.mellifera по
материнской линии.
Уровень
гетерозиготности
является одним из основных показателей в популяционно-генетическом
анализе пчел, характеризующий величину биологического и генного
разнообразия. Для популяции медоносной пчелы известно, что избыточная и
недостаточная гетерозиготность ведет к неблагоприятным явлениям. Для
популяции медоносной пчелы в норме, по результатам наших многолетних
исследований в России, свойственен небольшой дефицит гетерозигот
(Ильясов с соавт., 2008). Мы рассчитали величину средней наблюдаемой
гетерозиготности внутри субпопуляции HO и сравнили ее со средней
ожидаемой гетерозиготностью внутри субпопуляции. Во всей популяции по
всем микросателлитным локусам ядерной ДНК наблюдается дефицит
гетерозигот HO (0,413) < НS (0,444). Гетерозиготность внутри
субпопуляций НS (0,444) больше гетерозиготности между субпопуляциями
DST (0,039). Величина межпопуляционной генетической дифференциации GST
для всей популяции небольшая и приближается к значению 0,080.
Показатели
гетерозиготности для каждой локальной популяции также различались.
Наибольший дефицит гетерозигот наблюдался в иглинской локальной
популяции HO (0,562) < НS (0,469), а наименьший - в юсьвенской
HO
(0,347) < НS (0,389). Межпопуляционная составляющая
гетерозиготности
DST наименьшая в бурзянской локальной популяции DST (0,000), а
наибольшая - в иглинской DST (0,012). Соответственно, наименьшая
величина межпопуляционной генетической дифференциации GST наблюдается в
бурзянской локальной популяции GST (0,001), а наибольшая - в иглинской
GST (0,026).
На основе
изучения
полиморфизма 4 микросателлитных локусов были рассчитаны коэффициенты
инбридинга F-статистики для всей популяции. Расчет индекса фиксации
(Wright, 1965) FIS, отражающего инбридинг особи относительно
субпопуляции показал, что во всей популяции наблюдается дефицит
гетерозигот FIS (0,052) > 0. Индекс фиксации FIT, отражающий
инбридинг особи относительно всей общей популяции, также показал
дефицит гетерозигот во всей популяции, но на более высоком уровне FIT
(0,163) > 0. Индекс фиксации FST, отражающий инбридинг между
субпопуляциями относительно всей целой популяции, а также уровень
дифференцированности популяции показал, что популяция в целом
подразделена FST (0,117) на субпопуляции.
Индексы фиксации,
рассчитанные для субпопуляций были следующие. По значениям FST наименее
подразделенной оказалась бурзянская популяция FST (0,001), а наиболее
подразделенной иглинская FST (0,028). Наибольший уровень инбридинга и
дефицит гетерозигот на уровне субпопуляций FIS и на уровне всей
популяции FIT наблюдался в бурзянской популяции FIS (0,241) > 0
и
FIT (0,242) > 0, а наименьший - в юсьвенской популяции FIS
(0,099)
> 0 и FIT (0,115) > 0. В иглинской популяции наблюдался
аутбридинг с избытком гетерозигот FIS (-0,167) < 0 и FIT
(-0,135)
< 0.
На основе
стандартных
генетических расстояний (Nei, 1978) по данным анализа полиморфизма
локуса COI-COII митохондриальной ДНК и микросателлитных локусов ap243,
4a110, a24 и a8 была построена дендрограмма с использованием
кластерного анализа методом ближайшего соседа, используя в качестве
меры связи метод Варда, а меры расстояния - Евклидову дистанцию. На
дендрограмме наблюдается распределение локальных популяций на два
кластера, где максимально гибридизованная иглинская популяция
группируется отдельно от двух других. Сходная картина распределения
локальных популяций наблюдается и в случае анализа только
микросателлитных локусов ядерной ДНК.
Проведенный нами
анализ
генетической структуры трех удаленных друг от друга локальных популяций
медоносной пчелы Южного и Среднего Урала показал их генетическую
дифференциацию и подразделенность на субпопуляции в целом. Отмечалась
совместная группировка юсьвенской популяции медоносной пчелы с
бурзянской, которая ранее была определена на основе генетических
исследований как популяция среднерусской пчелы Apis mellifera
mellifera. Это свидетельствует о происхождении юсьвенской локальной
популяции медоносной пчелы по ядерной и митохондриальной ДНК от подвида
A.m.mellifera. Ранее определенная на основе генетических исследований
гибридная иглинская локальная популяция медоносной пчелы в данном
исследовании располагалась отдельно. Следует отметить характерный для
большинства популяций медоносной пчелы на Урале небольшой дефицит
гетерозигот и инбридинг. Гибридная иглинская популяция, наоборот,
характеризуется избытком гетерозигот и аутбридингом. Таким образом, на
Южном (Бурзянский район республики Башкортостан) и Среднем Урале
(Юсьвенский район Коми-Пермяцкого округа Пермского края) еще
сохранились локальные популяции медоносной пчелы подвида A.m.mellifera
с достаточными для длительного существования популяции во времени
величиной ареала и численности.
We have collected
honey
bees Apis mellifera out of 43 families with 2 apiaries Reserve
Shulgan-Tash Burzyansky district of the republic of Bashkortostan
(apiary Kapova-Cave Reserve cordon; apiary p.Koran-Elga) from 52
families with 6 Bashkir apiaries Research Station beekeeping iglinsky
district of the republic Bashkortostan (p.Ulu-Telyak, apiary Gareeva;
p.Ulu-Telyak, apiary matkovyvodnaya; p.Ulu-Telyak, apiary Orel;
p.Ulu-Telyak, apiary Kugeiko; p.Ulu-Telyak, apiary Gromov; p.Ulu
-Telyak, apiary Shamsurinskaya) from 37 families with 8 apiaries
Yusvenskogo region of Komi-Perm Territory Premyatskogo County
(s.Arhangelskoe, apiary Krivoshchekova DF .; s.Yusva, apiary NA Bykov
.; s.Pochashor, apiary Storozheva VM .; d.Fedotovo, apiary VD Vlasov .;
d.Fedorovo, apiary Boyandina AG d.B.Oni .; apiary, apiary d.Doeg;
d.Pozhva apiary). There were analyzed 132 families honeybee.
To study the
genetic
structure of the honey bee population of the Middle and South Urals, we
analyzed the polymorphism locus COI-COII mitochondrial DNA and
microsatellite loci ap243, 4a110, a24 and a8. The three local
populations of the honey bee (Burzyan, Iglinskiy and yusvenskaya)
observed the following frequencies alleys.
Intergenic locus
COI-COII mtDNA in honeybee represented 4 states, where Q is the only
element in the Urals describes the origin of the maternal line of the
sub-species of bees from southern regions - Amcaucasica, Amcarnica,
Amligustica and others. All other combinations of elements P and Q in
the Urals characterize the honeybee subspecies Ammellifera through the
maternal line. Burzyan yusvenskaya population and characterized by the
highest content of bees originating from Ammellifera through the
maternal line.
The level of
heterozygosity is one of the main indicators in the population genetic
analysis of the bees, which characterizes the value of biological and
genetic diversity. For the honeybee population is known that excessive
and insufficient heterozygosity lead to adverse events. For the
honeybee population is normal, according to the results of our many
years of research in Russia peculiar small deficit of heterozygotes
(Ilyasov et al., 2008). We have calculated the value of the average
observed heterozygosity in a subpopulation of HO and compared it with
the average expected heterozygosity in a subpopulation. In the entire
population of all the nuclear DNA microsatellite loci deficient
heterozygotes HO (0,413) <HS (0.444). Heterozygosity in
subpopulations HS (0.444) greater heterozygosity between subpopulations
DST (0,039). The value of inter-population genetic differentiation GST
for the entire population of a small and close to the value of 0.080.
Indicators of
heterozygosity for each local population is also different. The largest
deficit of heterozygotes was observed in the local population Iglinsky
HO (0,562) <HS (0.469), and the lowest - in yusvenskoy HO
(0,347)
<HS (0.389). Interpopulation DST smallest component of
heterozygosity in Burzyan local population DST (0,000), and the highest
- in Iglinsky DST (0,012). Accordingly, the minimum value of the
inter-population genetic differentiation is observed in the GST Burzyan
local populations GST (0,001), and the highest - in Iglinsky GST
(0,026).
Based on the
study of
polymorphism of 4 microsatellite loci were calculated inbreeding
coefficients F-statistic for the entire population. Calculation of the
index of fixation (Wright, 1965) FIS, reflecting individual inbreeding
relatively subpopulation showed that in the general population there is
a deficit of heterozygotes FIS (0,052)> 0. The index of fixation
of
FIT, which reflects inbreeding individuals relative to the whole
general population, also showed a deficit of heterozygotes in the
general population but at a higher level FIT (0,163)> 0. Index
fixing FST, reflecting inbreeding among subpopulations relative to the
entire population of the whole, and the level of differentiation of the
population showed that the population as a whole is divided FST (0,117)
in the subpopulation.
Fixation index
calculated for subpopulations were as follows. At least FST values
was subdivided Burzyan population FST (0,001), and the most
subdivided Iglinskiy FST (0,028). The highest level of inbreeding and a
lack of heterozygotes at subpopulations of FIS and the level of the
whole population was observed in the FIT Burzyan population FIS
(0,241)> 0 and FIT (0,242)> 0, and the lowest - in
yusvenskoy
population FIS (0,099)> 0 and FIT (0,115 )> 0. Iglinsky
outbreeding population was observed with an excess of heterozygotes FIS
(-0,167) <0 and FIT (-0,135) <0.
Based on standard
genetic distances (Nei, 1978) according to an analysis of polymorphism
locus COI-COII mitochondrial DNA and microsatellite loci ap243, 4a110,
a24 and a8 dendrogram was constructed using the cluster analysis method
of the nearest neighbor using a connection method as a measure of Ward
and measure the distance - Euclidean distance. In the dendrogram
observed distribution of local populations into two clusters, where the
most hybridized Iglinskiy population is grouped separately from the
other two. A similar pattern of distribution of local populations
observed in the case of the analysis of only the nuclear DNA
microsatellite loci.
Our analysis of
the
genetic structure of three widely separated local populations of the
honey bee South and Middle Urals demonstrated their genetic
differentiation and division into sub-population as a whole. There was
a joint group yusvenskoy honeybee population with Burzyan, which was
previously determined on the basis of genetic research as the
population of Central bee Apis mellifera mellifera. This indicates the
origin of the local population yusvenskoy honeybee on nuclear and
mitochondrial DNA from the subspecies Ammellifera. Previously defined
on the basis of genetic studies hybrid Iglinskiy local honeybee
population in this study has a separate. It should be noted
characteristic of the majority populations of the honey bee in the
Urals small deficit of heterozygotes and inbreeding. Hybrid Iglinskiy
population, by contrast, is characterized by an excess of heterozygotes
and outbreeding. Thus, in the South (Burzyan district of Bashkortostan)
and the Middle Urals (Yusvensky region of Komi-Perm district of the
Perm region) is still preserved local populations of the honey bee
subspecies Ammellifera with enough for a long time the existence of a
population the size of the area and population. |
085.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Филогенетический анализ
медоносной пчелы северной башкирской популяции. Материалы докладов XXIV
Любищевских чтений "Современные проблемы эволюции". Ульяновск. 2010. С.
113-119.
Нами
были просеквенированы нуклеотидные последовательности фрагмента интрона
гена фактора элонгации EF-1a у медоносных пчел из 3 семей с севера
ареала башкирской популяции Apis mellifera mellifera (Бирский район
республики Башкортостан). Как можно отметить, нуклеотидная
последовательность интрона гена фактора элонгации EF-1а ядерной ДНК
вариабельна среди представителей рода Apis – 105 вариабельных
сайтов, что составляет более 40%. Вариабельность этого локуса среди
представителей вида Apis mellifera, напротив, очень низка - 4
вариабельных сайта, что составляет около 2%. Кроме того, среди
представителей пчел рода Apis наблюдается большие участки с инсерциями
и делециями, которые не были использованы при подсчете уровня
вариабельности, что может повысить его уровень (Табл. 1).
По результатам
сравнительного анализа нуклеотидных последовательностей фрагмента
интрона гена фактора элонгации EF-1a семей медоносных пчел с севера
ареала башкирской популяции A.m.mellifera: 3504 Birsk Apis mellifera
mellifera (Бирск, Башкортостан); 3502 Birsk Apis mellifera mellifera
(Бирск, Башкортостан); 3503 Birsk Apis mellifera mellifera (Бирск,
Башкортостан) с последовательностями, опубликованными в генбанке:
Ay721702 Apis andreniformis, Ay721703 Apis andreniformis; Ay721704 Apis
dorsata, Ay721705 Apis dorsata, Ay721706 Apis dorsata; Ay721707 Apis
dorsata, Ay721708 Apis florea; Ay721709 Apis florea; Ay721710 Apis
mellifera ligustica; Ay721711 Apis koschevnikovi; Ay721712 Apis
koschevnikovi; Ay721713 Apis koschevnikovi, Ay721714 Apis
koschevnikovi; Ay721715 Apis koschevnikovi; Ay721716 Apis mellifera
lamarckii; Ay721717 Apis nuluensis (Arias, Sheppard, 2005) методом
кластеризации ближайшего соседа программой MEGA 3.1 была построена
дендрограмма генетических отношений разных видов рода Apis (Рис. 1).
На дендрограмме
наблюдается разделение на четыре группы. Представители каждого вида
преимущественно кластеризуются в отдельные группы. В первую группу
вошли представители западной медоносной пчелы вида Apis mellifera,
обладающие довольно низким уровнем вариабельности между подвидами. Сюда
же вошли представители Apis mellifera mellifera Южного Урала. Во вторую
группу вошли представители гигантских азиатских пчел вида Apis dorsata,
характеризующиеся малой степенью вариабельностью между экотипами. В
третью группу вошли представители азиатских пчел видов Apis
koschevnikovi и Apis nuluensis. Эти два вида пчел имеют очень низкую
степень генетической дифференциации между собой, тогда как некоторые
экотипы Apis koschevnikovi отличаются очень сильно. В четвертую группу
вошли представители азиатских карликовых пчел видов Apis andreniformis
с Apis florea. Представители каждого из них располагаются в отдельных
подгруппах, которые дифференцированы на относительно высоком уровне. Из
всех проанализированных видов пчел рода Apis гигантские пчелы вида Apis
dorsata наиболее генетически близки к западной пчеле вида Apis
mellifera.
Секвенционный
анализ
фрагмента интрона гена фактора элонгации EF-1a, возможно, позволяет
провести филогенетическую реконструкцию рода Apis, что также
представлено в работе M.C.Arias, W.S.Sheppard (2005). Предполагается,
что даже наблюдаемый низкий уровень дивергенции позволит получить
данные о филогенетическом паттерне вида Apis mellifera при исключении
из анализа представителей других видов рода Apis, на фоне высокого
уровня вариабельности которых внутривидовая вариабельность Apis
mellifera существенно принижается.
В дальнейшем мы
попытались провести филогенетический анализ внутри вида A.mellifera. На
основе сравнительного анализа нуклеотидных последовательностей
фрагмента интрона гена фактора элонгации EF-1a вида A.mellifera семей с
севера ареала башкирской популяции A.m.mellifera с последовательностями
Ay721710 A.mellifera ligustica и Ay721716 A.mellifera lamarckii,
опубликованными в генбанке, методом кластеризации ближайшего соседа
программой MEGA 3.1 нами была построена дендрограмма филогенетических
отношений разных подвидов Apis mellifera (Рис. 2). Представители разных
подвидов на дендрограмме группируются раздельно. Это показывает
возможность использования фрагмента интрона гена фактора элонгации
EF-1a для решения вопросов внутривидовой филогении, несмотря на то, что
между подвидами наблюдаются только 4 сайта замен (Табл. 1). Таким
образом ядерный маркер - интрон гена фактора элонгации EF-1a эффективен
в решении проблем систематики и филогенетики как на родовом, так и
видовом уровнях. Такое свойство этого маркера можно применить к
российским условиям, так как уже давно отмечается проблема массовой
гибридизации подвидов медоносной пчелы из южных и северных регионов
России. В частности, для республики Башкортостан существует проблема
сохранения аборигенного подвида A.m.mellifera от гибридизации с
привозными медоносными пчелами разных подвидов из южных регионов России
и Ближнего Зарубежья. Ранее нами для идентификации подвидов медоносной
пчелы использовались преимущественно маркеры митохондриальной ДНК.
Дополнительное использование ядерных маркеров наряду с
митохондриальными позволит пролить свет на процессы и пропорции
отцовского и материнского наследования в гибридных популяциях
медоносной пчелы.
We have sequenced
the
nucleotide sequence of a fragment of an intron of the gene elongation
factor EF-1a in honey bees from three families from the north area of
the Bashkir population of Apis mellifera mellifera (Birsky region of
the republic of Bashkortostan). As can be noted, the nucleotide
sequence of intron of the elongation factor EF-1a nuclear DNA is
variable among members of the genus Apis - 105 variable sites,
representing more than 40%. The variability of this locus among the
species Apis mellifera, on the contrary, very low - 4 variable site,
which is about 2%. Furthermore, among the genus Apis bees observed
large areas with insertions and deletions, which were not used in
calculating the level of variability that can increase its level
(Table. 1).
According to the
results
of the comparative analysis of the nucleotide sequences of the intron
of the gene fragment elongation factor EF-1a family of honeybees from
the north area of the Bashkir population Ammellifera: 3504 Birsk Apis
mellifera mellifera (Birsk, Bashkortostan); 3502 Birsk Apis mellifera
mellifera (Birsk, Bashkortostan); 3503 Birsk Apis mellifera mellifera
(Birsk, Bashkortostan) with sequences published in GenBank: Ay721702
Apis andreniformis, Ay721703 Apis andreniformis; Ay721704 Apis dorsata,
Ay721705 Apis dorsata, Ay721706 Apis dorsata; Ay721707 Apis dorsata,
Ay721708 Apis florea; Ay721709 Apis florea; Ay721710 Apis mellifera
ligustica; Ay721711 Apis koschevnikovi; Ay721712 Apis koschevnikovi;
Ay721713 Apis koschevnikovi, Ay721714 Apis koschevnikovi; Ay721715 Apis
koschevnikovi; Ay721716 Apis mellifera lamarckii; Ay721717 Apis
nuluensis (Arias, Sheppard, 2005) by the nearest neighbor clustering
program MEGA 3.1 was constructed dendrogram genetic relationships of
different species of the genus Apis (Fig. 1).
In the observed
dendrogram divided into four groups. Representatives of each species
predominantly clustered into individual groups. The first group
included representatives of the western honey bee species Apis
mellifera, have relatively low variability between subspecies. This
also includes representatives of Apis mellifera mellifera Southern
Urals. The second group included representatives of the giant Asian bee
species Apis dorsata, characterized by a low degree of variability
among ecotypes. The third group included representatives from the Asian
bee species Apis koschevnikovi and Apis nuluensis. These two types of
bees have a very low degree of genetic differentiation between them,
while some ecotypes of Apis koschevnikovi differ greatly. The fourth
group includes representatives of Asian dwarf bee species Apis
andreniformis with Apis florea. Representatives of each of them are
located in separate groups which are differentiated to a relatively
high level. Of all the analyzed species of the genus Apis bees giant
bee species Apis dorsata most genetically close to the western bee
species Apis mellifera.
Sekventsionny
analysis
fragment intron of the elongation factor EF-1a, may allows for
phylogenetic reconstruction of the genus Apis, which is also
represented in the MCArias, WSSheppard (2005). It is expected that even
low levels of divergence observed will provide data on the phylogenetic
pattern of species Apis mellifera to the exclusion from the analysis of
other species of the genus Apis, coupled with a high level of
variability that intraspecific variability of Apis mellifera
significantly belittled.
In the future, we
tried
to carry out phylogenetic analysis within the species A.mellifera. On
the basis of a comparative analysis of the nucleotide sequences of the
intron of the gene fragment elongation factor EF-1a species A.mellifera
families from the north area of the Bashkir population Ammellifera
sequences Ay721710 A.mellifera ligustica and Ay721716 A.mellifera
lamarckii, published in GenBank, the nearest neighbor clustering method
MEGA program 3.1 we constructed a dendrogram of phylogenetic
relationships of different subspecies Apis mellifera (Fig. 2).
Representatives of different subspecies in the dendrogram grouped
separately. This shows the possibility of using a gene intron fragment
elongation factor EF-1a to address intraspecific phylogeny, despite the
fact that between the subspecies observed only substituting 4 sites
(Tab. 1). Thus the nuclear marker - intron gene elongation factor EF-1a
is effective in solving problems of systematics and phylogenetics as
generic and species levels. This property of this marker can be applied
to Russian conditions, as has long been noted the problem of mass
hybridization honeybee subspecies of the southern and northern regions
of Russia. In particular, for the Republic of Bashkortostan there is
the problem of preservation of aboriginal subspecies Ammellifera by
hybridization with imported honeybees of different subspecies of the
southern regions of Russia and abroad. Earlier we have to identify
subspecies of honeybee mainly used mitochondrial DNA markers. The
additional use of nuclear markers along with mitochondrial will shed
light on the processes and proportions of paternal and maternal
inheritance in hybrid populations of the honey bee. |
084.
Николенко А.Г., Ильясов Р.А., Поскряков А.В. Информативность
полиморфизма мт-ДНК медоносной пчелы Apis mellifera L. (Hymenoptera:
Apidae) в популяционно-генетических исследованиях. Материалы II
Симпозиума стран СНГ по перепончатокрылым насекомым. Санкт-Петербург.
2010. С. 106.
Зональные
перемещения пчел, скрещивание разных подвидов в про граммах улучшения и
размножения привели к потере некоторых полезных свойств генофонда. За
последние 60-70 лет во многих регионах России и странах Западной Европы
произошла (и происходит) массовая гибридизация пчел, что привело к
необратимым процессам, препятствующим восстановлению исходного местного
генофонда. В результате сильно пострадала среднерусская пчела, которая
практически исчезла в некоторых местах ее традиционного разведения
(Черевко, 2005; Кривцов, 2000,2008). Тем не менее в России еще
сохранились резервы генофонда А т. mellifera L., которые можно
использовать для восстановления популяции на границах его естественного
ареала (Билаш, 1991; Лебедев, Билаш, 1991; Кривцов, 2005). Одной из
наиболее известных популяций темной лесной пчелы является башкирская,
фактические данные о состоянии генофонда которой публиковались в
последнее десятилетие лишь несколькими авторами. В 2000 г. на основе
анализа полиморфизма межгенного локуса COICOII мтДНК и морфометрических
данных на территории Башкортостана показано существование лишь одной
сохранившейся аборигенной бурзян- ской популяции А. т. mellifera
(Саттаров, Николенко, 2000; Николенко, Поскряков, 2002). В дальнейшем
поиск сохранившихся резерватов генофонда этого подвида был продолжен, и
на севере республики (Татышлин ский район) была обнаружена еще одна
локальная популяция А. гп. те lifera (Ильясов и др., 2006). Мы
предположили, что ареал северной попу ляции А. т. mellifera республики
может быть шире (Шареева и др., ^ Для сохранения генофонда ценного
подвида А. т. mellifera как в ^ сии, так и в Республике Башкортостан,
необходимо иметь несколько г ^ тических резерватов, располагать
информацией об их поп^ЛЯЦИ1°ьНЫХ генетической структуре и
границах
ареалов составляющих его лок популяций (Николенко, Поскряков, 2002).
Zonal movement of bees, crossing different subspecies in the pro grams
improvement and propagation led to some loss of useful the properties
of the gene pool. Over the past 60-70 years in many regions of Russia
and Western Europe there was (and is happening) mass hybridisation
bees, leading to irreversible processes, hindering recovery source of
local gene pool. As a result, severely damaged Central Russian bee,
which has virtually disappeared in some places its traditional breeding
(Cherevko, 2005; Krivtsov, 2000.2008). Nevertheless, the Russian
Federation remains of the gene pool reserves A m. Mellifera L., which
can be used to restore the population in the the limits of its natural
range (Bilash, 1991; Lebedev, Bilash, 1991; Krivtsov, 2005). One of the
most known populations of the dark forest Bashkir bee is, the actual
data on the state of the gene pool which were published in the last
decade, only a few authors. In 2000, based on the analysis of
polymorphism of the intergenic locus COICOII mtDNA and morphometric
data in Bashkortostan It demonstrated the existence of only one
surviving aboriginal burzyan- tion of the population of A. m. mellifera
(Sattar, Nikolenko, 2000; Nikolenko, Poskryakov, 2002). In the future,
search for the remaining reserves of the gene pool this subspecies was
continued, and in the north of the country (Tatyshlin sky district) was
discovered another local population of A. r. those lifera (Ilyasov et
al., 2006). We assumed that the area of the northern ass tion A. m.
mellifera republic may be wider (Shareeva et al., ^ To preserve the
gene pool of valuable subspecies A. m. Mellifera in ^ these, as well as
in the Republic of Bashkortostan, it is necessary to have some r cal
reserves, to have information about their pop LYATSI1 ° ^ NYH
genetic
structure and boundaries of areas of its component Locos populations
(Nikolenko, Poskryakov, 2002). |
083.
Фахретдинова С.А., Ильясов Р.А., Поскряков А.В., Николенко А.Г.
Определение границ бурзянской популяции медоносной пчелы Apis mellifera
mellifera L. Материалы третьей международной научно-практической
конференции "Актуальные вопросы энтомологии". Ставрополь. 2010. С.
154-155.
На Урале известно несколько
сохранившихся популя -
mellifera mellifera L. В Башкирии это северная и южная (Т ^ ская)
популяции. Уникальность бурзянской популяции заюткГ^' ся в высокой
степени естественной изоляции, вследствие чего^' пуляция меньше
подвержена гибридизации. Кроме того, этоо™ из наиболее
интактных
популяций тёмной лесной пчелы среди™ хранившихся в наши дни.
Бурзянская
популяция характеризуется также наличием большого числа бортевых семей.
Для решения проблемы сохранения генофонда как бортевых пчел, так и
популяции в целом важно знать генетические процессы происходящие внутри
и в краевых зонах популяции. Кроме того, бортевые пчелы не обладают
минимальной численностью для сохранения генофонда и нуждаются в
постоянном его пополнении за счет пасечных пчел. Анализ полиморфизма
митохондриального (межгенный локус С 0 1 - С 0 П ) и ядерного (локусы
ар243, 4а 110, ар049 и а24) геномов показал, что бурзянская популяция
сохранилась практически чистопородной. Небольшая степень гибридизации,
обнаруженная нами на территории заповедника Шульган-Таш, ничтожнамала.
Такой умеренный, на наш взгляд, приток генов не д о лж е н вы вать
серьезных нарушений в генофонде с у б п о п у л я ц и и . ^
Определилась часть границ ареала бурзянской подул ^ верные (Белорецкий
р-н), восточные (Абзелиловскии Р восточные (Баймакский р-н) и западные
(КугаРчинс* ^ ареала зовский и Ишимбайский р-ны). Такие очертания ^гр^
ге0Гр3фи- объясняются, прежде всего, естественными ФаКр ° ^
яНСКий
Ра1*оН ческим положением и растительным покровом. УР ^ й
длатаУ’
расположен в долине между двумя хребтами. Р ^ оЛЯЦЙи и сП\ что
обеспечивает высокую степень е с т е с т в е н н о й ^ ^ стороН^ жит
естественным барьером на пути потока ге районов н, „ет н а с
ел ен ны х
пунктов, что тоже способствуе т е километры » твеНной
границей ареала.
Восточную Гизоляиии и служи у тау> обесПечивает также природная
1яиЦУ- кРоМепес^ в „ практически полное отсутствие медоносов,
зона
‘осНОВ“ 1 и из Зилаирского района показал, что бу
рзянская диализ
вьГО°РК‘паНИЧивается пределами Бурзянского района,
„опуляиия не 01 р
часть границы ареала бурзянской популяции установлено> енно п0
границе с Кугарчинским районом, проходит неп и показала принадлежность
этих пчел к кавказ- выборка из к п '|б р н д и з о в а н нЫ е пчелиные
семьи могут находить- СК0'Непосредственной близости к заповеднику
Шульган-Таш в его юго-западной части. In the Urals there are several
surviving popula- - mellifera mellifera L. In Bashkortostan is the
northern and southern (T ^ Skye) population. The uniqueness of the
population Burzyan zayutkG ^ ' Xia highly natural insulation, whereby ^
' populations less susceptible to hybridization. In addition, Eto'o
™
of the most intact populations of bees among the dark forest
™ kept
today. Burzyan population characterized as the presence of a large
number of family tree hollow. To solve the problem of preservation of
the gene pool as a tree hollow bees and the general population, it is
important to know the genetic processes occurring both inside and in
the marginal areas of the population. Moreover, wild-hive the bees do
not have the minimum number to save genetic resources and need constant
replenishment of its by beekeeping bees. Analysis of mitochondrial
polymorphism (intergenic locus C 0 1 - P P 0) and nuclear (loci ar243,
4a 110 ar049 and A24) genomes It showed that the population remained
virtually Burzyan thoroughbred. A small degree of hybridization
detected us on the reserve Shul'gan-Tash nichtozhnamala. Such moderate,
in our opinion, the influx of genes of the left ventricle is not d e n
you Vat serious violations in the gene pool with y b n o p y l i i and
u. ^ Define the boundaries of the area Burzyan blew ^ right (Beloretsk
district), eastern (P Abzelilovsky Eastern (Baimaksky district) and
western (* ^ KugaRchins area zovsky Ishimbay and districts). These
outlines ^ c ^ ge0Gr3fi- explained primarily by natural faqr °
^ Jansky
PA1 * oH cal position and vegetation. UR ^ th dlataU ' Located in a
valley between two mountain ranges. Pj oLYaTsYi and SP \ which provides
a high degree of e s t e s t e n n in a second side of the ^ ^ ^ tains
a natural barrier to the flow areas n n, "a district and ate with us en
pips, which is also contributing to the te kilometers "Twain border
area. East Gizolyaiii and served with tau> also provides a
natural
1yaiTsU- kRoMepes ^ in "almost complete absence of honey plants, Zone
'of "1 and from Zilair district showed that boo rzyanskaya Dialysis vGO
° RK'paNIChivaetsya outside Burzyansky area "01 p opulyaiiya
not part
of the border area population Burzyan set> enno n0 Kugarchinskim
border area, ting passes and showed those belonging to the Caucasian
bees a sample of n '| b n d p and s to us in a n e bee colonies can be
situated SK0'Neposredstvennoy proximity to the reserve Shulgan-Tash in
his south-western part.
|
082.
Салтыкова Е.С., Ильясов Р.А., Гайфуллина Л.Р., Поскряков А.В., Ямиданов
Р.С., Николенко А.Г. Экспрессия антимикробных пептидов абецина и
дефензина в организме медоносной пчелы Apis mellifera mellifera.
Материалы третьей международной научно-практической конференции
"Актуальные вопросы энтомологии". Ставрополь. 2010. С. 85.
Антимикробные
пептиды (АМП) в организме медоносной пчелы играют важную роль в
иммунитете и выживаемости. Два наиболее известных из них дефензин и
абецин. Нами был проведен ПЦР в режиме реального времени по результатам
поставленного эксперимента при однократном кормлении пчел 0,001%
раствором хитозана. После кормления пчел экстрагировалась мРНК, на
основе которой синтезировалась кДНК для последующей ПЦР в режиме
реального времени (ПЦР РВ). Целью нашего эксперимента стала проверка
влияния хитозана на уровень экспрессии антимикробных пептидов абецина и
дефензина у медоносной пчелы. Ген MGST в эксперименте использовался в
качестве контроля, как ген, на экспрессию которого не должно влиять
кормление хитозаном.
Нами были
получены
данные об уровне изменения экспрессии каждого антимикробного пептида в
отдельности в двух повторностях. По результатам поставленных
экспериментов после кормления пчел хитозаном можно заключить, что
уровень экспрессии дефензина имеет тенденцию к увеличению на 142%
(P=0,053) в 1 эксперименте и на 96% (P=0,033) во 2 эксперименте.
Уровень экспрессии абецина увеличился на 188% (P<0,001) в 1
эксперименте и на 100% (P<0,001) во 2 эксперименте.
Таким образом,
можно
предположить, что однократное кормления пчел 0,001% раствором хитозана
приводит к заметному увеличению уровня экспрессии антимикробных
пептидов дефензина (в 2-2,8 раз) и абецина (в 1,9-2,4 раза) в организме
медоносной пчелы Apis mellifera mellifera.
Antimicrobial
peptides
(AMPs) in the body of the honeybee play an important role in immunity
and survival. The two most prominent of these defensin and abetsin. We
carried out the PCR in real time from the results of the experiment
with a single staged feeding of bees 0.001% solution of chitosan. After
feeding, the bees extracted mRNA from which the cDNA was synthesized
for subsequent PCR in real time (real-time PCR). The purpose of our
experiment was to check the effect of chitosan on the level of
expression of antimicrobial peptides and abetsina defensin in the
honeybee. MGST gene used in the experiment as a control as the gene for
expression of which should not affect feeding chitosan.
We obtained data
on the
changes in the expression level of each of the antimicrobial peptide
separately in duplicate. According to the results of experiments set
after feeding bees chitosan it can be concluded that the expression
level of defensin tends to increase by 142% (P = 0,053) in one
experiment and by 96% (P = 0,033) in the two experiments. The
expression level of abetsina increased by 188% (P <0,001) in
experiment 1 and 100% (P <0,001) in the 2nd experiment.
Thus, it can be
assumed
that a single foraging bees 0.001% chitosan solution leads to a marked
increase in the level of expression of defensin antimicrobial peptides
(in 2-2,8 times) abetsina (a 1.9-2.4-fold) in the body of the honeybee
Apis mellifera mellifera. |
081.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Генное разнообразие и
коэффициенты инбридинга медоносной пчелы в локальной популяции на
севере Республики Башкортостан. Материалы III всероссийской
научно-практической конференции "Полевые и экспериментальные
исследования биологических систем". Ишим. 2010. С. 66-68.
Естественный
ареал Apis mellifera L. охватывает всю Африку, Европу и Ближний Восток.
Отличительная черта вида – значительная внутривидовая
дифференциация (Ruttner, 1988). По современной классификации (Engel,
1999) вид подразделен на 25 подвидов. За последние 60-70 лет
во
многих регионах России и странах Западной Европы произошла массовая
гибридизация пчел, что привело к необратимым процессам, препятствующим
восстановлению исходного местного генофонда. В результате сильно
пострадала среднерусская пчела, которая практически исчезла в некоторых
местах ее традиционного разведения (Черевко, 2005; Кривцов, 2000, 2008).
В России еще
сохранились
резервы генофонда A.m.mellifera, которые можно использовать для
восстановления популяции на границах его естественного ареала (Билаш,
1991; Лебедев, Билаш, 1991; Кривцов, 2005). Одной из наиболее известных
популяций темной лесной пчелы является башкирская, фактические данные о
состоянии генофонда которой публиковались в последнее десятилетие лишь
несколькими авторами. В 2000 году на основе анализа полиморфизма
межгенного локуса COI-COII мтДНК и морфометрических данных на
территории Республики Башкортостан было показано существование лишь
одной сохранившейся аборигенной бурзянской популяции A.m.mellifera
(Саттаров, Николенко, 2000; Николенко, Поскряков, 2002). В дальнейшем
поиск сохранившихся резерватов генофонда этого подвида был продолжен, и
на севере республики была обнаружена еще одна локальная популяция A. m.
mellifera в Татышлинском районе Республики Башкортостан (Ильясов с
соавт., 2006). Для сохранения генофонда ценного подвида A.m.mellifera
как в России, так и в Республике Башкортостан, необходимо иметь
несколько генетических резерватов, располагать информацией об их
популяционно-генетической структуре и границах ареалов составляющих его
локальных популяций (Николенко, Поскряков, 2002). Целью исследований
было изучение структуры популяции медоносной пчелы северного ареала
Республики Башкортостан.
Нами были изучены
пчелы
с 42 пасек трех северных районов (Бирский, Караидельский, Мишкинский).
Всего было проанализировано по микросателлитным локусам ар243, 4а110 и
А8 ядерной ДНК пчел из 211 семей исследуемых районов Республики
Башкортостан. В изучаемой выборке пчел нами были рассчитаны
F-коэффициенты и гетерозиготность. Использование в анализе
F-коэффициентов и гетерозиготностей позволяет наиболее полноценно и
всесторонне охарактеризовать популяции и сравнивать их с аналогичными
показателями других популяций. Кроме того, эти характеристики позволяют
говорить о процессах, происходящих в популяции и прогнозировать
дальнейшую динамику популяции. Анализ средних значений последних по
микросателлитным локусам ap243, 4a110 и А8 ядерной ДНК (Табл. 1)
показал, что популяция северного ареала башкирской пчелы
характеризуется низким уровнем генетической дифференциации (FST=0,015)
между субпопуляциями, что свидетельствует о возможном единстве
происхождения пчел из этих популяций.
Близкие к нулю
значения
коэффициентов инбридинга (FIS=0,122 и FIT=0,135) и близкие значения
наблюдаемой (HО=0,435) и ожидаемых (HS=0,485 и HТ=0,493) показателей
гетерозиготности отражают баланс между инбридингом и аутбридингом, как
в отдельных субпопуляциях, так и во всей популяции, в целом, а также
свидетельствуют о том, что распределение генотипов по всем локусам
приближается к равновесному по Харди-Вайнбергу. Такое равновесное
состояние дает возможность длительного существования популяции в
современных неизменных условиях окружающей среды.
Таблица 1
F-коэффициенты и
гетерозиготность популяции северной ареала башкирской пчелы
A.m.mellifera
FST*
FIS FIT
HО HS HТ
0,015
0,122 0,135
0,435 0,485
0,493
* FST - средний
уровень
генетической дифференциации между субпопуляциями; FIS –
средний
уровень инбридинга и отклонение от пропорций Харди-Вайнберга внутри
субпопуляций; FIT – средний уровень инбридинга и отклонение
от
пропорций Харди-Вайнберга во всей популяции; HT - средняя ожидаемая
гетерозиготность во всей популяции между локусами; HO –
средняя
наблюдаемая гетерозиготность внутри субпопуляций между локусами; Hs
– средняя ожидаемая гетерозиготность внутри субпопуляций
между
локусами.
Таким образом,
популяция
северного ареала башкирской пчелы A.m.mellifera характеризуется
отсутствием подразделенности между населениями пчел Бирского,
Караидельского и Мишкинского районов. Минимальное отклонение от
равновесия Харди-Вайнберга свидетельствует об устойчивости популяции во
времени и незначительном влиянии на нее факторов эволюции. Наблюдаемые
коэффициенты инбридинга в популяции можно принять за оптимальные
равновесные значения, которые сложились в течение продолжительного
времени становления северной популяции A.m.mellifera, которые можно
использовать в сравнении с другими популяциями.
The natural
habitat of
Apis mellifera L. covers the whole of Africa, Europe and the Middle
East. A distinctive feature of the form - a significant intraspecific
differentiation (Ruttner, 1988). According to modern classification
(Engel, 1999) view is divided into 25 sub-species. Over the past 60-70
years in many regions of Russia and countries of Western Europe there
was a mass of bees hybridization, leading to irreversible processes,
prevent recovery of the original local gene pool. As a result, I
suffered greatly Central Russian bee, which has virtually disappeared
in some areas of its traditional breeding (Cherevko, 2005; Krivtsov,
2000, 2008).
The Russian
Federation
remains of the gene pool reserves Ammellifera, which can be used to
restore the population on the borders of its native range (Bilash,
1991; Lebedev, Bilash, 1991; Krivtsov, 2005). One of the most famous
dark forest bee populations is Bashkir, evidence on the state of the
gene pool which is published in the last decade, only a few authors. In
2000, based on the analysis of polymorphism of the intergenic locus
COI-COII mtDNA and morphometric data on the territory of the Republic
of Bashkortostan has been shown the existence of only one surviving
indigenous populations Burzyan Ammellifera (Sattar, Nikolenko, 2000;
Nikolenko, Poskryakov, 2002). In the future, search for the remaining
reserves of the gene pool of this subspecies was continued, and in the
north of the country has found another local population of A. m.
mellifera in Tatyshlinskom area Bashkortostan (Ilyasov et al., 2006).
To preserve the gene pool of valuable subspecies Ammellifera both in
Russia and in the Republic of Bashkortostan, it is necessary to have
some genetic reserves, to have information about their
population-genetic structure and the boundaries of the ranges of its
constituent local populations (Nikolenko, Poskryakov, 2002). The aim
was to study the structure of the honey bee population of the northern
area of the Republic of Bashkortostan.
We have studied
bees
with 42 apiaries three northern regions (Birsky, Karaidelsky,
Mishkinskoye). There were analyzed for microsatellite loci ar243, 4a110
and A8 nuclear DNA of 211 families of bees studied areas of the
Republic of Bashkortostan. In our sample of bees we calculated F-ratios
and heterozygosity. Using the analysis of F-ratios and heterozygous
allows most fully and comprehensively characterize the population, and
to compare them with those of other populations. In addition, these
characteristics allow us to speak about the processes occurring in the
population and to predict the future dynamics of the population.
Analysis of the average of the last of microsatellite loci ap243, 4a110
A8 and nuclear DNA (Table. 1) showed that the population of the
northern area of the Bashkir bee is characterized by a low level of
genetic differentiation (FST = 0,015) between subpopulations,
suggesting a possible common origin of these populations of bees .
Near-zero
coefficient of
inbreeding (FIS = 0,122 and FIT = 0,135) and similar values observed
(HO = 0.435) and expected (HS = 0,485 and HT = 0.493) heterozygosity
indices reflect a balance between inbreeding and outbreeding, in
certain subpopulations, as and in the population as a whole, as well as
evidence that the distribution of genotypes at all loci close to the
equilibrium of Hardy-Weinberg equilibrium. This equilibrium state
allows continued existence of the population in modern constant
environmental conditions.
Table 1
F-ratios and
heterozygosity of the population of northern area of the Bashkir bee
Ammellifera
FST * FIS FIT BUT
HS HT
0.015 0.122 0.135
0.435 0.485 0.493
* FST - the
average
level of genetic differentiation between subpopulations; FIS - average
level of inbreeding and deviation from Hardy-Weinberg proportions
within subpopulations; FIT - the average level of inbreeding and
deviation from Hardy-Weinberg proportions in the general population; HT
- average expected heterozygosity in the total population between loci;
HO - average observed heterozygosity in subpopulations between loci; Hs
- the average expected heterozygosity in subpopulations between loci.
Thus, the
population of
the northern area of the Bashkir bee Ammellifera characterized by
lack of division between the population of bees Birsk, Karaidelskogo
and Mishkinsky areas. Minimum deviation from Hardy-Weinberg equilibrium
demonstrates the stability of the population in time and insignificant
effect on her evolutionary factors. The observed rates of inbreeding in
the population can be taken for optimal equilibrium values that have
been established for a long time the formation of northern populations
Ammellifera, which can be used in comparison with other populations. |
080.
Салтыкова Е.С., Ильясов Р.А., Гайфуллина Л.Р., Поскряков А.В., Ямиданов
Р.С., Николенко А.Г. Изменение уровня экспрессии антимикробных пептидов
в организме медоносной пчелы Apis mellifera mellifera L. Материалы
международнародной научно-практической конференции "Современное
пчеловодство. Проблемы, опыт, новые технологии". Ярославль. 2010. С.
159-160.
Антимикробные
пептиды (АМП) в организме медоносной пчелы играют важную роль в
иммунитете и выживаемости. Два наиболее известных из них дефензин и
абецин. Нами был проведен ПЦР в режиме реального времени по результатам
поставленного эксперимента при однократном кормлении пчел 0,001%
раствором хитозана. После кормления пчел экстрагировалась мРНК, на
основе которой синтезировалась кДНК для последующей ПЦР в режиме
реального времени (ПЦР РВ). Целью нашего эксперимента стала проверка
влияния хитозана на уровень экспрессии антимикробных пептидов абецина и
дефензина у медоносной пчелы. Ген MGST в эксперименте использовался в
качестве контроля, как ген, на экспрессию которого не должно влиять
кормление хитозаном.
Нами были
получены
данные об уровне изменения экспрессии каждого антимикробного пептида в
отдельности в двух повторностях. По результатам поставленных
экспериментов после кормления пчел хитозаном можно заключить, что
уровень экспрессии дефензина имеет тенденцию к увеличению на 142%
(P=0,053) в 1 эксперименте и на 96% (P=0,033) во 2 эксперименте.
Уровень экспрессии абецина увеличился на 188% (P<0,001) в 1
эксперименте и на 100% (P<0,001) во 2 эксперименте (Таб. 1),
(Рис.
1).
Таким образом,
можно
предположить, что однократное кормления пчел 0,001% раствором хитозана
приводит к заметному увеличению уровня экспрессии антимикробных
пептидов дефензина (в 2-2,8 раз) и абецина (в 1,9-2,4 раза) в организме
медоносной пчелы Apis mellifera mellifera.
Antimicrobial
peptides
(AMPs) in the body of the honeybee play an important role in immunity
and survival. The two most prominent of these defensin and abetsin. We
carried out the PCR in real time from the results of the experiment
with a single staged feeding of bees 0.001% solution of chitosan. After
feeding, the bees extracted mRNA from which the cDNA was synthesized
for subsequent PCR in real time (real-time PCR). The purpose of our
experiment was to check the effect of chitosan on the level of
expression of antimicrobial peptides and abetsina defensin in the
honeybee. MGST gene used in the experiment as a control as the gene for
expression of which should not affect feeding chitosan.
We obtained data
on the
changes in the expression level of each of the antimicrobial peptide
separately in duplicate. According to the results of experiments set
after feeding bees chitosan it can be concluded that the expression
level of defensin tends to increase by 142% (P = 0,053) in one
experiment and by 96% (P = 0,033) in the two experiments. The
expression level of abetsina increased by 188% (P <0,001) in
experiment 1 and 100% (P <0,001) in experiment 2 (Table. 1)
(Fig. 1).
Thus, it can be
assumed
that a single foraging bees 0.001% chitosan solution leads to a marked
increase in the level of expression of defensin antimicrobial peptides
(in 2-2,8 times) abetsina (a 1.9-2.4-fold) in the body of the honeybee
Apis mellifera mellifera. |
079.
Колбина Л.М., Непейвода С.Н., Масленников И.В., Воробьева С.Л., Ильясов
Р.А., Поскряков А.В., Николенко А.Г. Генетический и морфологический
анализ породности пчелиных семей шарканского и завьяловского районов
удмуртской республики. Материалы международнародной научно-практической
конференции "Современное пчеловодство. Проблемы, опыт, новые
технологии". Ярославль. 2010. С. 71-73.
На сегодняшний день существует
две основные методики определения породной принадлежности пчел, ни одну
из которых не стоит
абсолютизировать.
Молекулярно-генетическая методика позволяет
оценить
происхождение
пчелиных семей независимо от их морфологических признаков и часто
позволяет ныинить гибридов в тех случаях, когда методика оценки
жетерьера дает сбои. Но, несмотря на все дос шине 1 на
молекулярно-генетической методики у нее есть и cvuKCTHCHHbiii
недостаток. Поскольку аборигенными пчелами для нсего 11оно.1ЖЬЯ, н том
числе и Удмуртии были среднерусские пчелы, то есть пчелы Apis mellifera
mellifera L., а завезенные семьи южных пород составляли небольшой
процент от общего количества разводимых пчел. Это привело к тому, что
большая часть гибридизации местных пчел произошла по мужской линии,
которую использованная молекулярно-генетическая методика, к сожалению,
учесть не может, С другой стороны большая вариабельность
морфологических признаков, появившаяся в результате гибридизации,
привела к тому, что часть помесных пчел может по экстерьеру
соответствовать среднерусской породе, ей по сути не являясь. Поэтому
достоверные результаты могут быть получены только при использовании как
морфологических, так и молекулярно-генетических методов исследования.
Нами были
проанализированы пчелиные семьи из двух районов Шарканского (2 пасеки -
15 семей из села Нижнее Корякино и 19 из Шаркана) и Завьяловского (3
пасеки - 19 семей из села Люк, 15 - Постол и 5 - из деревни Макарово).
Был проведен сравнительный популяционно-генетический анализ пчелиных
семей этих двух районов, а также сравнительный анализ отдельно по
пасекам на основе изучения межгенного локуса COI-COII мтДНК.
Исследования по
генетическому анализу проводилась совместно с РА. Ильясовым, А.Г.
Николенко из института биохимии и генетики Уфимского научного центра
РАН. Основу генетического анализа составил установленный ранее
полиморфизм межгенного локуса COI-COII у представителей разных подвидов
A.mellifera. Установлено, что протяженный АТ-богатый межгенный участок
мтДНК. локализованный между генами COI и СОИ. не кодирующий
аминокислотной последовательности, может быть использован в качестве
маркера для различения подвидов A.m.mellifera и A.m.caucasica благодаря
вариабельности длины, обусловленной различным соотношением элементов Р
и Q, где межгенный участок у представителей ветви М (A.m.mellifera),
аборигенных для республики, имеет комбинацию PQQ, тогда как у
представителей ветви С (A.m.caucasica, A.m.camica. A.m.ligustica),
гибридизация с которыми наблюдается на территории республики, имеется
единственный элемент Q. Таким образом, межгепный локус СО [-СО II мтДНК
у представителей эволюционной ветви С и их гибридов по материнской
линии на 268 п.н. короче межгенного локуса COI-COII мтДНК у
представителей ветви М, и эти локусы легко разделяются при
электрофорезе. Размер продукта ПЦР межгенного локуса COI-COII мтДНК,
включающий и ген тРНКЬеи у представителей A.m.mellifera, равен примерно
600 п.н., а у представителей эволюционной ветви С и их гибридов по
материнской линии - 350 п.н. Этот маркер был использован нами для
поиска популяций A.m.mellifera.
Для
сравнительного
анализа была использована методика оценки экстерьера согласно
рекомендациям всероссийского научноисследовательского института
пчеловодства.
При изучении
межгенного
локуса COI-COII митохондриальной ДНК, при анализе по двум районам
(табл.1.) заметно, что встречаемость строения межгенного локуса Q
больше чем в два раза выше в завьяловский популяции, что говорит о
происхождении 38,5% пчелиных семей завьяловской популяции по
материнской линии от пчел южных пород. Кроме этого следует отметить
наличие в Шарканской популяции аномального строения межгенного локуса
С01-С0П митохондриальной ДНК PQ. Обнаруженные различия между этими
двумя популяциями достоверны (Р<0,05).
В результате ни
одна из
исследованных популяций не может быть отнесена к среднерусской породе
пчел. При этом две популяции - люкская и макаровская, по материнской
линии происходят по данным анализа митохондриальной ДНК
предположительно происходят от Apis mellifera mellifera. однако сильно
гибридизорованы по отцовской линии. В это же время, несмотря на
неоднородное происхождение, шарканская популяция сохранила больше
признаков аборигенной среднерусской породы. Корякннская популяция при
совместном рассмот рении генетических и морфологических данных ближе
всех остальных к абориилшой популяции среднерусских пчел.
Today, there are
two basic methods for determining the breed of bees, none of which is
not necessary
absolute.
Molecular genetic technique allows
to assess the
origin of
bee families, regardless of their morphological characters and often
allows nyinit hybrids in cases where assessment methodology zheterera
faltering. But, despite all the dos bus 1 at the molecular and genetic
techniques, and it has cvuKCTHCHHbiii disadvantage. As for native bees
nsego 11ono.1ZhYa, including Mr. and Udmurtia were Central Russian
bees, ie bee Apis mellifera mellifera L., and imported breeds of
southern families represent a small percentage of the total farmed
bees. This led to the fact that most of the hybridization of native
bees occurred in the male line, which used molecular genetic
techniques, unfortunately, can not be taken into account, on the other
hand a large variability in morphological characters, which appeared as
a result of hybridization has led to the fact that part of the hybrid
Bees can match the exterior of the Central Russian breed, it is
essentially not being. Therefore, accurate results can be obtained only
when using both morphological and molecular genetic methods.
We analyzed bee
families
of the two areas Sharkansky (2 apiaries - 15 families from the village
of Lower Koryakina and 19 of shuffling) and Zavyalovsky (3 apiaries -
19 families from the village of Luc, 15 - Postol and 5 - from the
village Makarovo). A comparative population-genetic analysis of
colonies of these two areas, as well as a comparative analysis
separately for apiaries based on the study of intergenic locus COI-COII
mtDNA.
Studies on the
genetic
analysis was conducted in conjunction with RA. Ilyasov, AG Nikolenko
from the Institute of Biochemistry and Genetics, Ufa Scientific Center,
Russian Academy of Sciences. The basis of genetic analysis was
installed earlier polymorphism intergenic locus COI-COII
representatives of different subspecies A.mellifera. It was found that
the extended AT-rich intergenic site mtDNA. localized between genes COI
and soybeans. does not encode an amino acid sequence it can be used as
a marker to distinguish between subspecies Ammellifera and variability
thanks Amcaucasica length due to various elements of the relationship
of P and Q, where the representatives of intergenic site branches of M
(Ammellifera), native to the country, is a combination of PQQ whereas
the representatives of branches with (Amcaucasica, Amcamica.
Amligustica), hybridization with whom there is in the country, there is
a unique element Q. So mezhgepny locus CO [-CO II mtDNA from
representatives of evolutionary branches with their hybrids maternal
268 bp short intergenic locus COI-COII mtDNA from representatives of
branches of M and these loci are easily separated by electrophoresis.
The size of the PCR product intergenic locus COI-COII mtDNA gene and
comprising the representatives tRNKei Ammellifera, is about 600 bp, and
the representatives of the evolutionary branches with their hybrids and
the maternal line - 350 bp This marker was used to search for our
populations Ammellifera.
For a comparative
analysis was used according to the method of estimating exterior
All-Russian scientific and research institute of the recommendations of
the bee.
In the study of
intergenic locus COI-COII mitochondrial DNA, the analysis of the two
areas (Table 1). Evident that the incidence structure intergenic locus
Q more than twice as high in Zavyalovsky population that speaks of the
origin of 38.5% of bee colonies Zavyalovsky Population maternal bees
southern rock. In addition, it should be noted the presence of an
abnormal population structure Sharkan intergenic locus C01-S0P
mitochondrial DNA PQ. The differences between these two populations
were significant (P <0.05).
As a result, none
of the
studied populations can not be attributed to the Central Russian breed
of bees. At the same time two populations - lyukskaya and Makarovskaya,
maternal occur according to the analysis of mitochondrial DNA
presumably come from Apis mellifera mellifera. however much
gibridizorovany paternal. At the same time, despite the origin of the
non-uniform, Sharkan population kept growing signs native of Central
Russian breed. Koryaknnskaya population is under the joint rhenium
Consider genetic and morphological data closer to the rest of the
population aboriilshoy Central Russian bees. |
078.
Fakhretdinova S.A., Ilyasov R.A., Poskryakov A.V., Nikolenko A.G.
Granice zasiegu populacji pszczol miodnych Burzyan gatunku Apis
mellifera mellifera L. Materials of international conference "XLVII
Naukowa konferencja pszczelarska". Pulawy. 2010. P. 56.
Na
Uralu
wyst^puje kilka populacji Apis mellifera mellifera L. W Baszkirii
najbardziej znana to populacja Burzyan. Jest to jedna z najbardziej
bliskich naturze, zyj^cych w stanie dzikim pszczola. Pszczoly Burzyan
charakteryzuj^ si^ glownie tym, iz gniazda swoje buduj^ w dziuplach
drzew. W celu zachowania puli genowej populacji pszczol Burzyan powinno
okreslic si^ dokladnie granice zasi^gu ich wyst^powania. W tym celu,
przyst^pilismy do zbierania danych dotycz^cych wyst^powania tej
pszczoly w powiecie Burzyan. Dokonano analizy polimorfizmu
mitochondrialnego (locus intergenic COI-COII) i j^drowego (loci ap243,
4a110, ap049 i a24) w genomie ww populacji . Wyniki wskazuj^ na
utrzymywanie si^ populacji w calej badanej strefie. Okreslono granice
zasi^gu populacji Burzyan: polnocna (Beloretsky), wschodnia
(Abzelilovsky), poludniowo-wschodnia (Baymaksky) i zachodnia
(Kugarchinsky, Meleuzovsky i Ishimbaysky). Mozna to wyjasnic
korzystnymi warunkami naturalnymi: polozenie geograficznym, jak i
wyst^powaniem specyficznej roslinnosci. Powiat Burzyan jest bowiem
polozony w dolinie mi^dzy dwoma pasmami gorskimi: Ural-Tau i Alatau.
Stanowi to zatem naturaln^ barier^ dla swobodnego przeplywu genow. W
granicach administracyjnych Ishimbaysky, Meleuzovsky na przestrzeni
wielu kilometrow kwadratowych znajduj^ si^ tereny nie zamieszkale, co
przyczynia si^ takze do utrwalenia izolacji i utrzymania granic zasiogu
wyst^powania pszczol Burzyan. Po wschodniej stronie granicy kraju
wyst^puje glownie obszar lasow sosnowych, co w znacznym stopniu ulatwia
zachowanie czystosci genetycznej omawianej populacji. |
077.
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Comparative sequencing
analysis intron of elongation factor ef1-alpha of honeybees from
Russian Ural. Materials of international conference "XLVII Naukowa
konferencja pszczelarska". Pulawy. 2010. P. 57.
Comparative
sequencing analysis of variability (>40 per cent) intron of
elongation factor gene EF1-alpha of nuclear DNA can be used in
phylogenetic reconstruction genus Apis. In this work we have for the
first time shown possibility using this marker in phylogenetic
reconstruction in Apis mellifera species, in spite of its low
intraspecific variability (<2 per cent).
We were made
sequencing
analysis fragment intron of elongation factor gene EF1-alpha of honey
bees from 3 colonies of a northern area of Bashkir population honeybees
Apis mellifera mellifera (Russia, Birsky region of Bashkortostan
republic). Comparative analysis was made with published in genebank
sequences: Apis andreniformis (Ay721702, Ay721703, Ay721704), Apis
dorsata (Ay721705, Ay721706, Ay721707), Apis florea (Ay721708,
Ay721709), Apis mellifera ligustica (Ay721710), Apis koschevnikovi
(Ay721711, Ay721712, Ay721713, Ay721714, Ay721715); Apis mellifera
lamarckii (Ay721716); Apis nuluensis (Ay721717) (Arias, Sheppard, 2005).
Using cluster
analysis
we construct dendrogram by neighbor-joining method. On dendrogram bee
samples had differentiated into four branches. Samples of different bee
species clustered in separate branches. The first branch included
samples of western honeybee Apis mellifera. Apis mellifera mellifera
from Ural located separately from other subspecies. Samples of gigantic
Asian bees of genus Apis have differentiated into a second branch of
Apis dorsata. Asian bees of species Apis koschevnikovi and Apis
nuluensis included into a third branch. These two bee species had low
level of genetic differentiating among themselves. The fourth branch
included bee species of Asian dwarf bees of species Apis andreniformis
and Apis florea. Bee samples of each of them separated in different
subgroups.
|
076.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Cравнительный
секвенционный анализ вариабельного интрона гена фактора элонгации 1
альфа ядерного генома пчел рода Apis. В мире научных открытий. 2010. №
3 (09). Ч.3. С. 33-35.
Нами
был использован сравнительный секвенционный анализ вариабельного
интрона гена фактора элонгации EF-1а ядерной ДНК с целью определения
филогенетического паттерна пчел рода Apis. На дендрограмме наблюдается
разделение на четыре группы, где в 1 группу вошли подвиды Apis
mellifera, во 2 группу – представители гигантских пчел Apis
dorsata, 3 группу – виды Apis koschevnikovi и Apis nuluensis,
в 4
группу – карликовые пчелы Apis andreniformis и Apis florea.
Ключевые слова:
Apis
mellifera mellifera, Apis, медоносная пчела, интрон гена фактора
элонгации EF-1a, секвенирование, кластерный анализ, дендрограмма,
филогенетика.
We used
comparative
analysis sekventsionny variable intron of elongation factor EF-1 a
nuclear DNA in order to determine the phylogenetic pattern of bees
genus Apis. In the observed dendrogram divided into four groups, where
one group comprised subspecies Apis mellifera, the 2nd group -
representatives of giant bees Apis dorsata, group 3 - species Apis
koschevnikovi and Apis nuluensis, 4 group - dwarf bee Apis
andreniformis and Apis florea.
Keywords: Apis
mellifera
mellifera, Apis, honeybee, intron gene elongation factor EF-1a,
sequencing, cluster analysis, dendrogram, phylogenetics. |
075.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Генетический полиморфизм
медоносной пчелы Apis mellifera mellifera L. южно-уральской
горно-лесной популяции. Материалы Всероссийской научно-практической
конференции "Актуальные проблемы сохранения биоразнообразия на
охраняемых и иных территориях". Уфа. 2010. С. 190-193.
Целью нашей работы был анализ
молекулярно-генетической структуры
бурзянской популяции Apis mellifera mellifera L., определение
фаниц ареала и оценка степени ее полиморфизма. Для решения этих задач,
с мая по
сентябрь 2009 года, были взяты пробы в значительной части Бурзянского
района, а
также в сопредельных населенных пунктах Абзелиловского, Кугарчинского,
Белорецкого, Баймакского и Зилаирского районов. Всего нами было собрано
695 образцов
пчел со 119 пасек и И бортей. Материал исследовался на подвидовую
принадлежность, частоту встречаемости аллелей, разнообразие генотипов.
Нами был
изучен полиморфизм микросатсллитных локусов ар243, 4а110, ар049, а24
ядерной
ДНК. По результатам анализа частот аллелей микросатсллитных локусов
были
получены генетические расстояния, на основе которых кластерным анализом
методом
ближайшего соседа была построена дендрофамма генетических отношений
населений
пчел изучаемых нами популяций. На дендрофамме наблюдалось подразделение
на 3
крупные ветви. Первая ветвь включала население пчел д. Атиково
Бурзянского
района, д. Иргизлы Бурзянского района, д, Старомусятово Бурзянского
района, д.
Новомусятово Бурзянского района; вторая - д. Кана Бурзянского района,
д.
Старосубхангулово Бурзянского района, д. Крутой лог Абзелиловского
района, д.
Сюрень Кугарчинского района; третья - д. Ямашево Бурзянского района. По
результатам анализа наблюдаемых и ожидаемых частот генотипов
микросателлитных
локусов ар243, 4аПО, ар049, а24 ядерной ДНК был рассчитан коэффициент
инбридинга Fis
для
изучаемых нами субпопуляций. Наибольший уровень инбридинга наблюдается
в центре
популяции (Fis
изменялся от 0,22 до 0,45), а наименьший, максимально приближенный к
состоянию
равновесия - в д. Атиково Бурзянского района (Fis=0,15) и д. Сюрень
Кугарчинского
района республики Башкортостан (Fis=0,12).
Для всех субпопуляций характерно наличие инбридинга и отсутствие
аутбридинга. Таким
образом, анализ полиморфизма ядерной и митохондриальной ДНК показал,
что
бурзянская популяция сохранилась практически чистопородной.
Определилась часть
фаниц ареала бурзянской популяции: северные (Белорецкий р-н), восточные
(Абзелиловский
р-н), юго-восточные (Баймакский р-н) и западные (Кугарчинекий,
Мелеузовский и
Ишимбайский районы). Установлено, что часть фаницы ареала бурзянской
популяции
медоносной пчелы проходит непосредственно по фанице с Кугарчи неким
районом, гибридизованные
пчелиные семьи могут находиться в непосредственной близости к
заповеднику
Шульган-Таш в его юго-западной части. Анализ полиморфизма выборок из
Абзелиловского, Баймакского, Белорецкого ^ Зилаирского районов, может
быть
подтверждением гипотезы о более широком ареале бурзянской популяции
медоносной
пчелы Apis mellifera mellifera.
The aim of our work was to
analyze the molecular genetic structure Burzyan populations Apis
mellifera
mellifera L., fanits definition and assessment of the range of its
polymorphism. To solve these problems, from May to September 2009,
samples were
taken in a large part of Burzyansky area, as well as in the neighboring
Abzelilovsky
settlements, Kugarchinskogo, Beloretsk, Baimak and Zilair areas. In
total we
collected 695 samples of bees and apiaries with 119 and sides. The
material was
investigated on subspecies, the frequency of alleles, diversity of
genotypes. We
have studied the polymorphism loci mikrosatsllitnyh ar243, 4a110,
ar049, A24
nuclear DNA. According to the analysis of allele frequencies
mikrosatsllitnyh
genetic loci were obtained distances at based cluster analysis method
was
nearest neighbor It built dendrofamma genetic attitude of the
population of
bees we study populations. On dendrofamme observed Unit 3 large
branches. The
first branch included population bee d. Atikovo Burzyansky area on.
Irgizly
Burzyansky area, etc., Staromusyatovo Burzyansky district, d.
Novomusyatovo
Burzyansky area; second - d. Burzyansky Cana region, d.
Starosubhangulovo Burzyansky
district, d. Abrupt log Abzelilovsky district, d. Suresnes
Kugarchinskogo area;
third - d. Yamasheva Burzyansky area. According to the analysis of the
observed
and expected frequencies genotypes of microsatellite loci ar243, 4aPO,
ar049,
A24 nuclear DNA was calculated inbreeding coefficient Fis we study
subpopulations.
The highest level of inbreeding observed in the center population (Fis
varied
from 0.22 to 0.45), and the lowest maximum close to equilibrium - in
the
village. Atikovo Burzyansky District (Fis = 0,15) and d. Kugarchinskogo
Suresnes district of the republic Bashkortostan (Fis = 0,12). For all
subpopulations characterized inbreeding and outbreeding absence. Thus,
the
analysis of polymorphisms of nuclear and mitochondrial DNA showed that
the
population remained Burzyan almost thoroughbred. Determine the area of
the
fanits Burzyan population: the northern (Beloretsk district), eastern
(Abzelilovsky
district), southeastern (Baimaksky district), and Western
(Kugarchineky,
Meleuzovsky and Ishimbay areas). INSTALLATIONS, that part of the area
fanitsy
Burzyan honeybee population It goes directly to fanitse Kugarchi
certain area, hybridized
bee colonies may be in close proximity to the reserve Shulgan-Tash in
its
southwestern part. Analysis polymorphism in samples from Abzelilovsky,
Baimak,
Beloretsk ^ Zilair areas can be confirmation of the hypothesis of a
more wide
area Burzyan population of honey bee Apis mellifera mellifera.
|
074.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Генное разнообразие
медоносной пчелы в локальной популяции на севере республики
Башкортостан. Материалы III Всероссийской научно-практической
конференции "Биологические системы: устойчивость, принципы и механизмы
функционирования". Нижний Тагил. 2010. С. 261.
Генное
разнообразие является важнейшей характеристикой популяций, позволяющей
определить ее устойчивость в целом. Целью нашей работы являлось
изучение на основе анализа полиморфизма 5 микросателлитных локусов
(Ap243, 4a110, A8, A43, A113) ядерной ДНК генетического разнообразия
локальной популяции пчел на территории двух северных районов республики
Башкортостан (Балтачевский (N=36) и Бирский(N=65)), ранее отнесенный
нами к части ареала A.m.mellifera башкирского экотипа.
Таблица 1
Основные
генетические характеристики локальной популяции медоносной пчелы
республики Башкортостан
Локус
Ho Hs
Ht
Fis Qintra
Qinter
Fst Fit
Hбалт Hбир
Ap243
0,272 0,539
0,536
0,478 0,283
0,542
-0,010
0,473
0,525 0,552
4a110
0,527 0,531
0,530
0,009 0,533
0,537
-0,004
0,005
0,501 0,561
A8
0,371 0,409
0,425
0,107 0,391
0,438
0,069 0,169
0,274
0,543
A43
0,460 0,428
0,444
-0,124
0,500
0,445 0,066
-0,050
0,352 0,505
A113
0,091 0,187
0,187
0,524 0,087
0,183
0,001 0,524
0,525
0,552
Все
0,344 0,419
0,424
0,164 0,359
0,429
0,026 0,185
0,501
0,561
По результатам
анализа
полиморфизма 5 микросателлитных локусов (Ap243, 4a110, A8, A43, A113)
ядерной ДНК нами были рассчитаны показатели F-статистики и
гетерозиготности (Таб. 1). Популяция в целом по всем локусам испытывает
незначительный дефицит гетерозигот Ho (0,344)< Hs (0,419), Ht
(0,424) и Fit (0,185). Генное разнообразие в популяции пчел Бирского
района Hбир (0,466)> чем Балтачевского Hбалт (0,372). Среднее
генное
разнообразие по всем локусам внутри особи Qintra (0,359)< чем
между
особями Qinter (0,429). Гетерозиготность на уровне субпопуляций Hs
(0,419)< гетерозиготности для всей популяции Hs (0,424).
Коэффициент
дифференциации Fst (0,026) показывает очень малую степень
внутрипопуляционной локальной дифференциации.
Таким образом,
можно
предположить, что в локальной популяции пчел двух районов республики
Башкортостан (N=101) наблюдается отсутствие подразделенности и
небольшая степень генетической изоляции. Предполагается, что между
локальными популяциями пчел этих двух районов возможен неограниченный
поток. Большой запас генного разнообразия обнаруживается на
межпопуляционном уровне. По частотам генотипов не наблюдается
значительного отклонения от равновесия Харди-Вайнберга.
Genetic diversity
of honey bees in locales Noi POPULATION IN THE NORTH BASHKORTOSTAN
Genetic diversity
is an
essential characteristic of populations, allowing to determine its
stability as a whole. The aim of our work was to study the analysis of
polymorphism of 5 microsatellite loci (Ap243, 4a110, A8, A43, A113)
nuclear DNA genetic diversity of local bee populations in the two
northern regions of the Republic of Bashkortostan (Baltachevsky (N =
36) and Birsky (N = 65 )) was originally classified as a part of our
range Ammellifera Bashkir ecotype.
Table 1
Main genetic
characteristics of local honeybee population of the republic of
Bashkortostan
Locus Ho Hs Ht
Fis Qintra Qinter Fst Fit Hbalt Hbir
Ap243 0,272 0,539
0,536 0,478 0,283 0,542 -0,010 0,473 0,525 0,552
4a110 0,527 0,531
0,530 0,009 0,533 0,537 -0,004 0,005 0,501 0,561
A8 0,371 0,409
0,425 0,107 0,391 0,438 0,069 0,169 0,274 0,543
A43 0,460 0,428
0,444 -0,124 0,500 0,445 0,066 -0,050 0,352 0,505
A113 0,091 0,187
0,187 0,524 0,087 0,183 0,001 0,524 0,525 0,552
All 0.344 0.419
0.424 0.164 0.359 0.429 0.026 0.185 0.501 0.561
According to the
analysis of polymorphism of 5 microsatellite loci (Ap243, 4a110, A8,
A43, A113) nuclear DNA we calculated indicators F-statistics and
heterozygosity (Tab. 1). The population as a whole for all loci
experiencing a slight deficit of heterozygotes Ho (0,344) <Hs
(0,419), Ht (0,424) and Fit (0,185). Genetic diversity in the
population of bees Birsk district Hbir (0.466)> than
Baltachevskogo
Hbalt (0,372). Average genetic diversity for all loci in individuals
Qintra (0,359) <than between individuals Qinter (0,429).
Heterozygosity at subpopulations Hs (0,419) <heterozygosity for
the
entire population Hs (0,424). Differentiation factor Fst (0,026) shows
a very low degree of intra-local differentiation.
Thus, we can
assume that
the local bee population of the two districts of the republic of
Bashkortostan (N = 101), there is a lack of units and a small degree of
genetic isolation. It is assumed that between the local bee population
of the two areas is unrestricted flow. Large stock of genetic diversity
found in the interpopulation level. At frequencies of genotypes no
significant deviation from Hardy-Weinberg equilibrium. |
073.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Оценка генетического
разнообразия в локальной популяции медоносной пчелы двух районов
республики Башкортостан. Материалы I Всероссийской научно-практической
конференции с международным участием "Проблемы сохранения
биологического разнообразия волжского бассейна и сопредельных
территорий". Чебоксары. 2010. С. 35-36.
Генетическое
разнообразие является главным показателем процессов, происходящих в
популяции. На основе гетерозиготности также рассчитываются коэффициенты
инбридинга популяции - основные показатели генетической структуры
популяции. Целью нашей работы стало изучение генетического разнообразия
популяции пчел на территории двух северных районов (Балтачевский и
Бирский) Республики Башкортостан (табл. 1, рис. 1) на основе анализа
полиморфизма 5 микросателлитных локусов (Ар243, 4а110, А8, А43, А113)
ядерной ДНК. Fst - средний уровень генетической дифференциации между
субпопуляциями; Fis - средний уровень инбридинга и отклонение от
пропорций Харди-Вайнберга внутри субпопуляций; Fit - средний уровень
инбридинга и отклонение от пропорций Харди-Вайнберга во всей популяции;
Но - средняя наблюдаемая гетерозиготность внутри субпопуляций между
локусами; Hs - средняя ожидаемая гетерозиготность внутри субпопуляций
между локусами; Ht - средняя ожидаемая гетерозиготность во всей
популяции между локусами; Qintra - среднее генное разнообразие внутри
особей; Qinter - среднее генное разнообразие между особями; Нбалт -
генное разнообразие в локальной популяции пчел на территории
Балтачевского района Республики Башкортостан; Нбир - генное
разнообразие в локальной популяции пчел на территории Бирского района
Республики Башкортостан. По результатам анализа полиморфизма 5
микросателлитных локусов (Ар243, 4а110, А8, А43, А113) ядеркой ДНК нами
были рассчитаны такие показатели F-статистики и гетерозиготности (табл.
2). Как видно из таблицы, популяция в целом по всем локусам испытывает
очень незначительный дефицит гетерозигот Но (0,344)< Hs (0,419)
и Ht
(0,424). О дефиците гетерозигот говорит и Fis (0,164) для субпопуляций
и Fit (0,185). Однако, по некоторым локусам (А43) наоборот наблюдается
избыток гетерозигот Но (0,460)< Hs (0,428) и Ht (0,444), a Fis
(-0,124) и Fit (-0,050). Оценка генного разнообразия по всем локусам
для локальных популяций каждого района Республики Башкортостан
показывает, что оно больше в популяции пчел Бирского района Нбир
(0,466)> Нбалт (0,372), однако по некоторым локусам (А113)
генное
разннобразие больше в популяции пчел Балтачевского района Нбир
(0,206)> Нбалт (0,168). Оценка среднего генного разнообразия по
всем
локусам внутри (Qintra) и между особями (Qinter) в локальной популяции
пчел двух районов республики Башкортостан показала, что Qintra
(0,359)< Qinter (0,429). Однако по некоторым локусам (А43)
Qintra
(0,500)> Qinter (0,445). Такие же результаты дает
гетерозиготность,
которая на уровне субпопуляций Hs (0,419) меньше гетерозиготности для
всей популяции Hs (0,424). Коэффициент дифференциации популяций в
локальной популяции пчел двух районов Республики Башкортостан Fst
(0,026), что очень близко к нулевому значению. Это показывает очень
малую степень внутрипопуляционной локальной дифференциации. По
некоторым локусам (А8 и А43) Fst (0,069) и (0,066), что немного больше
значения Fst по всем локусам. Таким образом, можно предположить, что в
локальной популяции пчел двух районов (Бирский и Балтачевский)
Республики Башкортостан происходит небольшая степень изоляции от потока
генов из других локальных популяций пчел, что и привело к таким
значениям коэффициентов инбридинга Fis и Fit, Также возможно, что
отсутствие подраз- деленности популяций пчел двух районов республики
Башкортостан является дополнительной причиной положительных значений
коэффициентов инбридинга. Близкое к нулю значение коэффициента
подраэделенности свидетельствует о неограниченном потоке генов и
миграции между локальными популяциями пчел двух районов (Бирский и
Балтачевский) Республики Башкортостан, несмотря на их некоторую
незначительную географическую разобщенность. Генное разнообразие между
особями больше, чем внутри особей в среднем, что выявляет запас генного
разнообразия на популяционном уровне. Это может обеспечивать популяцию
запасом устойчивости и изменчивостью на популяционном уровне.
Genetic
diversity is the main indicator of the processes occurring in the
population. Based heterozygosity and inbreeding coefficients calculated
the population - the main indicators of the genetic population
structure. The aim of our work was to study the genetic diversity of
the population of bees in the territory two northern districts
(Baltachevsky and Birsky) RB (Table. 1, Fig. 1) based on an analysis 5
microsatellite loci polymorphism (Ar243, 4a110, A8, A43, A113) of
nuclear DNA. Fst - the average level of genetic differentiation between
subpopulations; Fis - the average level of inbreeding and deviation
from Hardy-Weinberg proportions within subpopulations; Fit - the
average level of inbreeding and the deviation from Hardy-Weinberg
proportions in the general population; But - the average observed
heterozygosity in subpopulations between loci; Hs - the average
expected heterozygosity in subpopulations between loci; Ht - average
expected heterozygosity in the total population between loci; Qintra -
the average gene diversity within individuals; Qinter - the average
genetic diversity between individuals; Nbalt - genetic diversity in the
local population bee on the territory of the Republic of Bashkortostan
Baltachevskogo area; Nbir - genetic diversity in the local bee
population in the territory of the Republic of Bashkortostan Birsk
area. According to the analysis of polymorphism of 5 microsatellite
loci (Ar243, 4a110, A8, A43, A113) Yaderku DNA we calculated these
indicators F-statistics and heterozygosity (Table. 2). As the table
shows, the population of in general, all the loci experiencing very
small deficit of heterozygotes But (0,344) <Hs (0,419) and Ht
(0.424). The deficit of heterozygotes and says Fis (0,164) for the
subpopulations and Fit (0,185). However, for some loci (A43) on the
contrary there is an excess of heterozygotes But (0,460) <Hs
(0,428)
and Ht (0,444), a Fis (-0,124) and Fit (-0,050). Assessment of genetic
diversity for all loci for local populations of each region of the
Republic of Bashkortostan shows that it is more in the bee population
Birsk area Nbir (0.466)> Nbalt (0.372), but for some loci (A113)
gene raznnobrazie more in the bee population Baltachevskogo district
Nbir (0.206)> Nbalt (0.168). Estimate of the average gene
diversity
at all loci in (Qintra) and between individuals (Qinter) local bee
population of the two districts of the republic of Bashkortostan showed
that Qintra (0,359) <Qinter (0,429). However, some loci (A43)
Qintra
(0,500)> Qinter (0,445). The same results are obtained
heterozygosity at which subpopulations Hs (0,419) less heterozygosity
for the entire population Hs (0,424). The coefficient of
differentiation of populations in the local bee population of the two
districts of the Republic of Bashkortostan Fst (0,026), which is very
close to zero. It shows a very low degree of intra- local
differentiation. For some loci (A8 and A43) Fst (0,069) and (0,066),
which is slightly greater than the Fst all loci. Thus, we can assume
that the local bee population of two districts (Birsky and
Baltachevsky) Republic of Bashkortostan takes a small degree of
isolation from the flow of genes from other local populations bees,
which led to such a coefficient of inbreeding Fis and Fit, also
possible that the absence of podraz- concreteness bee populations of
two districts of the Republic of Bashkortostan is an additional reason
for the positive coefficient of inbreeding. Close to zero coefficient
indicates podraedelennosti of unlimited gene flow and migration between
the local bee population of two districts (Birsky and Baltachevsky) of
the Republic of Bashkortostan, despite some minor geographical
fragmentation. Genetic diversity between individuals is greater than
the average within the individuals that brings the stock of genetic
diversity at the population level. This may provide population
stability margin and volatility the population level. |
072.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Охрана башкирской пчелы в
заповеднике Шульган-Таш. Материалы 3 Международной научно-практической
конференции "Сохранение разнообразия животных и охотничье хозяйство
России". Москва. 2009. С.36-37.
Первоначально
ареал медоносной пчелы Apis mellifera mellifera L. охватывал обширную
территорию от Британских островов до Урала, вдоль северной границы
распространения вида. На данный момент ее ареал значительно сократился
из-за внутривидовой гибридизации. Считается, что в настоящее время в
Западной Европе практически невозможно найти негибридизованные семьи
A.m.mellifera. В нашей стране A.m.mellifera также была подвержена
интенсивной гибридизации в результате завоза пчел из южных регионов
страны. Однако предполагалось, что в отдельных местах еще могли
сохраниться популяции A.m.mellifera. Среди сохранившихся локальных
популяций A.m.mellifera особо выделяется популяция башкирских бортевых
пчел Бурзянском районе республики Башкортостан и взятая под охрану в
заповеднике «Шульган-таш».
В 1958 году для
охраны
сохранившихся пчел A.m.mellifera в Бурзянском районе Республики
Башкортостан был создан Заповедник «Шульган-таш»
как филиал
«Прибельский» восстанавливаемого Башкирского
Государственного заповедника. В 1986 году по постановлению Совета
Министров РСФСР от 6 января он преобразован в самостоятельный
заповедник. Правительство РБ, администрации Бурзянского района и
заповедника Шульган-Таш уделяют большое внимание сохранению бурзянской
популяции. Большую помощь оказывают также международные организации, в
частности, Всемирный фонд охраны дикой природы (WWF). На территории
заповедника ведется племенная работа, администрацией района издан указ
о запрете на ввоз пчел других подвидов, в 1997 году создан заказник
«Алтын Солок». В 1997 году был создан заказник
«Алтын
Солок» и выделился как подразделение Бурзянского лесхоза. В
зоне
заказника находилось около 800 бортей, более 50 человек занимались
бортничеством. В конце 80-х годов администрациями района и Республики
был издан указ, запрещающий ввоз пчёл других подвидов на территорию
района.
Одним из основных
объектов охраны заповедника является башкирская пчела Бурзянского
района, которая является достоянием Республики Башкортостан. Эта пчела
отличаются чрезвычайной работоспособностью: в течение двух-трех недель
цветения липы они могут работать с раннего утра до позднего вечера и
способны даже в дождливую погоду, совершать огромное число вылетов, и
собирать до 10 кг нектара в день.
Бортевые пчелы
существуют в естественной среде, в суровых условиях и подвержены
жесткому естественному отбору. Однако они не могут существовать
абсолютно изолированно от пасек. Так как сама популяция бортевых пчел
небольшая, она нуждается в постоянном пополнении за счет пасечных пчел.
Поэтому окружающие пасеки играют большую роль. Между бортевыми пчелами
и пасечными идет постоянная миграция, и эти процессы помогают сохранить
популяцию. Подтверждением этого факта может послужить опыт
Южноуральского заповедника, где с исчезновением деревень полностью
исчезли и бортевые пчелы, хотя сами борти сохранились.
В настоящее время
намечается расширение территории заповедника Шульган-Таш, что поможет
сохранить биологическое и ландшафтное разнообразие широколиственных
лесов, а, следовательно, и сохранить среду обитания бурзянских пчел.
Расширение планируется примерно на 36 тыс. га в западном направлении.
Там находятся неосвоенные территории на стыке Мелеузовского,
Ишимбайского и Бурзянского районов, где нет населенных пунктов,
животноводческих объектов, лесозаготовок и сохранились нетронутые
человеком леса. В результате площадь охраняемых мест обитания
бурзянской пчелы вместе с национальным парком
«Башкирия» и
заказником «Алтын Солок» может увеличиться до 230
тыс. га.
При учреждении заповедника Шульган-Таш в его собственность были
переданы около 900 бортей, правда лишь треть из них оказалась пригодной
для эксплуатации. Поэтому в заповеднике ведется также работа по
изготовлению и оснащению бортей.
На данный момент
нет
данных о границе распространения популяции бурзянских пчел. Для
первоначальных исследований с целью определения распространения
бурзянских пчел были отобраны пчелы из 5 выборок: с. Старосубхангулово,
с. Новомусятово, с. Иргизлы Бурзянского района, с. Крутой Лог
Абзелиловского района, с. Сюрень Кугарчинского района Республики
Башкортостан. В исследовании были использованы: локус COI-COII мтДНК,
микросателлитные локусы ap243, 4a110, a8, a43 ядерной ДНК. Нами были
рассчитаны частоты встречаемости аллелей каждого локуса.
Частоты
встречаемости
комбинаций межгенного локуса COI-COII мтДНК были следующими: в
популяциях пчел всех выборок, кроме Сюрени, комбинация PQQ (маркер
A.m.mellifera) встречалась с частотой 1,0, тогда как в Сюрени
встречалась только комбинация Q (маркер A.m.caucasica) с частотой
1,0. Для получения информации о распределении популяций
необходимо рассчитать частоты аллелей и генетические расстояния.
На основе данных
о
частотах распределения аллелей были рассчитаны генетические расстояния.
Наибольшие расстояния наблюдается между популяциями Сюрень и Крутой
Лог; Сюрень и Старосубхангулово. Наименьшие расстояния - между Крутой
Лог и Новомусятово; Старосубхагулово и
Новомусятово. Такая
группировка, в некоторой степени согласована как с географическим
расположением, так и генетическим составом этих популяций. В
дальнейшем, был проведен кластерный анализ с использованием метода
ближайшего соседа и построена дендрограмма. Так, популяция Сюрень
отделяется от всех, так как в ней представлены в основном гибридные
семьи пчел. Картина кластерного анализа может отражать до некоторой
степени уровень миграции между популяциями, где наиболее близкие
популяции будут близки и генетически, тогда как отдаленные популяции
будут более изолированы друг от друга.
Таким образом,
проведенные исследования позволяют сделать вывод о том, что ареал
обитания бурзянской популяции башкирской пчелы A.m.mellifera, возможно
имеет расширение в восточном направлении в сторону Абзелиловского
района, тогда как на юге в Кугарчинском районе популяция была
подвержена значительной гибридизации.
The original area
of
the honey bee Apis mellifera mellifera L. covers a vast area from the
British Isles to the Urals, along the northern border of the species
distribution. At the moment, its range is much reduced because of
intraspecific hybridization. It is estimated that currently in Western
Europe is almost impossible to find a non-hybridized family
Ammellifera. In our country Ammellifera was also subject to intense
hybridization resulting in the importation of bees from the southern
regions of the country. However, it was assumed that in some places
could still keep the population Ammellifera. Among the remaining local
populations Ammellifera highlights Bashkir wild-hive bee population
Burzyan region of the republic of Bashkortostan and protected in the
reserve "Shulgan-Tash."
In 1958, for the
protection of the surviving bees Ammellifera Burzyan area in the
Republic of Bashkortostan was established reserve "Shulgan-Tash" as a
branch of "Pribelsky" restores the Bashkir State Nature Reserve. In
1986, by order of the RSFSR Council of Ministers of January 6, it is
converted into a separate reserve. The Government of the Republic of
Belarus, and the district administration Burzyansky Reserve
Shulgan-Tash pay great attention to the preservation Burzyan
population. Most care is provided by international organizations, in
particular, the World Wildlife Fund (WWF). Within the reserve is being
breeding work, the district administration issued a decree banning the
importation of bees other subspecies in 1997 created reserve "Altyn
Solok". In 1997, the reserve was established "Altyn Solok" and stood
out as a division Burzyansky forestry. In the area of the reserve was
about 800 board, more than 50 people were engaged in apiculture. In the
late 80-ies of the district administration and the Republic issued a
decree banning the importation of bees other subspecies in the
territory of the region.
One of the main
objects
of protection is to preserve the Bashkir bee Burzyansky district, which
is the property of the Republic of Bashkortostan. This bee are
extremely operability: within two or three weeks of flowering linden
they can work from early morning until late at night and can even in
the rain, to make a huge number of missions, and collect nectar up to
10 kg per day.
Wild-hive bee
exist in
the natural environment, in harsh conditions, and are subject to strict
natural selection. However, they can not be completely isolated from
the apiaries. Since the very small population of wild-hive of bees, it
needs constant replenishment due apiary bees. So the surrounding
apiaries play a big role. In the wild-hive bees and beekeeping is a
constant migration, these processes help keep the population. Proof of
this fact can serve as the experience of South Ural Reserve, where the
disappearance of the villages have completely disappeared and wild-hive
bee, though they remained aboard.
Currently planned
expansion of the reserve Shulgan-Tash, which will help keep the
biological and landscape diversity of deciduous forests, and,
consequently, save the environment Burzyan bees. The expansion is
scheduled for about 36 thousand. Ha in the western direction. There are
undeveloped territory at the junction Meleuzovsky, Ishimbaisky
Burzyansky and areas where there are no settlements, livestock
facilities, harvesting and preserved untouched by man of the forest. As
a result, the area of protected habitat Burzyan bee along with the
national park "Bashkiria" and reserve "Altyn Solok" may increase up to
230 thousand. Ha. In establishing the reserve Shulgan-Tash in his
possession were handed over about 900 board, though only a third of
them turned out to be suitable for use. Therefore, the reserve is also
ongoing work on the construction and equipping of the board.
There is
currently no
data on the spread of the border population Burzyan bees. For the
initial studies to determine the spread of Burzyan bee bees were
selected from 5 samples: a. Starosubhangulovo with. Novomusyatovo with.
Irgizly Burzyansky district with. Krutoy Log Abzelilovsky district
with. Suresnes Kugarchinskogo district of Bashkortostan. The study
used: locus COI-COII mtDNA microsatellite loci ap243, 4a110, a8, a43
nuclear DNA. We calculated the frequency of alleles for each locus.
The frequency of
occurrence of combinations intergenic locus COI-COII mtDNA were as
follows: in populations of bees of all samples except Suresnes
combination PQQ (marker Ammellifera) occurs with a frequency of 1.0,
whereas in Suresnes met only the combination Q (marker Amcaucasica)
with frequency 10. For information on the distribution of populations
is necessary to calculate allele frequencies and genetic distances.
Based on the
distribution of allele frequencies were calculated genetic distance.
The greatest distance observed between populations of Suresnes and
Krutoy Log; Suresnes and Starosubhangulovo. The shortest distance -
between Krutoy Log and Novomusyatovo; Starosubhagulovo and
Novomusyatovo. This grouping, to some extent consistent with both the
geographical location and the genetic composition of populations.
Further, the cluster analysis was conducted using the method of the
nearest neighbor and constructed dendrogram. Thus, the population is
separated from all of Suresnes, since it contains mainly hybrid bee
colonies. Painting cluster analysis may reflect to some degree the
level of migration between populations where populations are closest
and genetically close, while more distant populations are isolated from
each other.
Thus, our studies
suggest that habitat Burzyan Bashkir bee populations Ammellifera,
perhaps has the extension eastwards towards Abzelilovsky area, while in
the south district Kugarchinskom population exposed to significant
hybridization. |
071.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Распределение аллелей
микросателлитных локусов и локуса COI-COII мтДНК в популяции южной
части ареала башкирских пчел. Материалы II Всероссийской конференции
студентов, аспирантов и молодых учёных "Полевые и экспериментальные
исследования биологических систем". Ишим. 2009. С. 70-75.
Задачей
нашего исследования является изучение популяций пчел южной части ареала
башкирской пчелы. Ранее проведенные нами исследования показали, что
башкирские пчелы по таксономии относятся к подвиду A.m.mellifera.
Первоначально единственным местом сохранения чистых линий этой пчелы
считался небольшой регион на юге Башкортостана, входящий в состав
заповедника «Шульган-Таш» Республики Башкортостан.
Дальнейшие исследования относились преимущественно к северной части
ареала башкирской пчелы и не было проведено каких-либо исследований в
обнаруженной первоначально популяции A.m.mellifera южной части ареала.
Ареал этой южной локальной популяции не определен в точности, а именно,
совпадает ли ареал с границами Бурзянского района или он гораздо шире.
Для исследования
были
отобраны пчелы из 5 выборок: с. Старосубхангулово (10 семей), с.
Новомусятово (10 семей), с. Иргизлы (10 семей) Бурзянского района, с.
Крутой Лог (5 семей) Абзелиловского района, с. Сюрень (4 семьи)
Кугарчинского района Республики Башкортостан (рис. 1). В исследовании
были использованы: локус COI-COII мтДНК, микросателлитные локусы ap243,
4a110, a8, a43 ядерной ДНК. Нами были рассчитаны частоты встречаемости
аллелей каждого локуса.
Частоты
встречаемости
комбинаций межгенного локуса COI-COII мтДНК были следующими: в
популяциях пчел всех выборок, кроме Сюрени, комбинация PQQ (маркер
A.m.mellifera) встречалась с частотой 1,0, тогда как в Сюрени
встречалась только комбинация Q (маркер A.m.caucasica) с частотой 1,0.
Частоты аллелей микросателлитных локусов в изучаемых выборках
Старосубхангулово, Новомусятово, Иргизлы, Крутой Лог и Сюрень
представлены в таблице (таб. 1). Для получения информации о
распределении популяций необходимо рассчитать по частотам генетические
расстояния. Наиболее приемлемым расстоянием является генетическое
расстояние M. Nei (1978).
На основе данных
о
частотах распределения аллелей были рассчитаны генетические расстояния
(таб. 2). Наибольшие расстояния наблюдается между популяциями Сюрень и
Крутой Лог; Сюрень и Старосубхангулово. Наименьшие расстояния - между
Крутой Лог и Новомусятово; Старосубхагулово и
Новомусятово.
Такая группировка, в некоторой степени согласована как с географическим
расположением, так и генетическим составом этих популяций. В
дальнейшем, был проведен кластерный анализ с использованием метода
ближайшего соседа и построена дендрограмма (рис. 2). Так, популяция
Сюрень отделяется от всех, так как в ней представлены в основном
гибридные семьи пчел. Таким образом, картина кластерного анализа может
отражать до некоторой степени уровень миграции между популяциями, где
наиболее близкие популяции будут близки и генетически, тогда как
отдаленные популяции будут более изолированы друг от друга.
Таким образом,
проведенные исследования позволяют сделать вывод о том, что популяция
южного ареала башкирских пчел A.m.mellifera, возможно имеет расширение
в восточном направлении в сторону Абзелиловского района, тогда как на
юге в Кугарчинском районе популяция была подвержена значительной
гибридизации.
The aim of our
research
is to study the bee populations of southern part of the range of
Bashkir bee. Earlier studies have shown us that the Bashkir bee
taxonomy are subspecies Ammellifera. Initially, the only place save the
clean lines of the bees was considered a small region in the south of
Bashkortostan, which is part of the reserve "Shulgan-Tash" of the
Republic of Bashkortostan. Further studies are concerned mainly to the
northern part of the range of Bashkir bee and was not carried out any
research in the detected initial population Ammellifera southern part
of the range. The area south of the local population is not defined
precisely, but it coincides with the boundaries of any area or district
Burzyansky it is much wider.
For the study
were
selected from bees 5 samples: p. Starosubhangulovo (10 families), p.
Novomusyatovo (10 families), p. Irgizly (10 families) region Burzyansky
with. Krutoy Log (5 families) region Abzelilovsky with. Suresnes (4
families) region of the Republic of Bashkortostan Kugarchinskogo (Fig.
1). The study used: locus COI-COII mtDNA microsatellite loci ap243,
4a110, a8, a43 nuclear DNA. We calculated the frequency of alleles for
each locus.
The frequency of
occurrence of combinations intergenic locus COI-COII mtDNA were as
follows: in populations of bees of all samples except Suresnes
combination PQQ (marker Ammellifera) occurs with a frequency of 1.0,
whereas in Suresnes met only the combination Q (marker Amcaucasica)
with frequency 10. Allele frequencies of microsatellite loci in the
study sample Starosubhangulovo, Novomusyatovo, Irgizly, Krutoy Log
Suresnes and presented in a table (Table. 1). To obtain information
about the distribution of the populations must be calculated for the
frequency of genetic distance. The most acceptable is genetic distance
distance M. Nei (1978).
On the basis of
data on
the distribution of allele frequencies were calculated genetic
distances (Table. 2). The greatest distance observed between
populations of Suresnes and Krutoy Log; Suresnes and Starosubhangulovo.
The shortest distance - between Krutoy Log and Novomusyatovo;
Starosubhagulovo and Novomusyatovo. This grouping, to some extent
consistent with both the geographical location and the genetic
composition of populations. Subsequently, a cluster analysis was
performed using the nearest neighbor method and a dendrogram
constructed (Fig. 2). Thus, the population is separated from all of
Suresnes, since it contains mainly hybrid bee colonies. Thus, the
picture cluster analysis may reflect to some degree the level of
migration between populations where populations are closest and
genetically close, while more distant populations are isolated from
each other.
Thus, the studies
suggest that the population of the southern area of the Bashkir bee
Ammellifera, perhaps has the extension eastward toward Abzelilovsky
area, whereas in the south neighborhood Kugarchinskom population
exposed to significant hybridization. |
070.
Ильясов Р.А., Шареева З.В. , Поскряков А.В., Николенко А.Г.
Гетерогенность популяции северной части ареала башкирской пчелы.
Материалы V Международной научной конференции "Факторы
экспериментальной эволюции организмов". Алушта. 2009.С. 138-140.
Микросателлитный
локус ap243 был представлен тремя аллелями 1, 2 и 2. При этом с
максимальной частотой 0,80 аллель 1 была представлена в гибридной
иглинской выборке, а в остальных колебалась в пределах 0,42 –
0,58, тогда как караидельская выборка имела промежуточное значение
0,70. Напротив, аллель 2 была минимальна в иглинской выборке (0,12), а
в остальных варьировала в диапазоне 0,23-0,40. Реже всего встречалась
аллель 3, частота которой в изучаемых выборках (за исключением
бурзянской) в основном не превышала величины 0,10. В выборке из
бурзянской популяции аллель 3 была представлена с частотою 0,35, что
можно предположить в качестве маркера южной башкирской популяции.
Распределение генотипов данного локуса показало, что наиболее
представлен генотип 11 с частотой от 0,29 (бурзянская) до 0,70
(иглинская). Генотип 23 в бирской, караидельской и татышлинской
популяциях отсутствовал. Гибридная иглинская популяция явно отличалась
от остальных по частотам генотипа 11 – 0,70 и генотипа 22
–
0,03. Среди оставшихся также наблюдалась некоторая подразделенность:
бурзянская выборка выделялась по частоте 0,26 генотипа 33, а бирская
– мишкинская – караидельская группа – по
частоте от
0,26 до 0,38 генотипа 12.
По результатам
анализа
другого ядерного маркера, микросателлитного локуса 4а110, можно
отметить, что аллели 1 и 2 были представлены практически в равных
долях, тогда как аллель 3 встречалась очень редко, либо совсем
отсутствовала в выборках. Наиболее часто встречались генотипы 11
(0,20-0,60), 22 (0,10-0,28) и 12 (0,30-0,49). Частота встречаемости
генотипов 33, 13 и 23 по многим выборкам была низкой (<0,05), а
в
некоторых составляла 0. Иглинская выборка отличилась от других
частотами аллеля 1 (0,75 против 0,45-0,57 у прочих) и аллеля 2 (0,25
против 0,43-0,52), а также частотами генотипа 11 (0,60 против
0,20-0,33) и генотипа 22 (0,10 против 0,20-0,28). Частоты аллелей и
генотипов в других выборках были приблизительно равными.
При изучении
микросателлитного локуса А8 ядерной ДНК в исследуемых выборках пчел был
обнаружен более широкий спектр аллелей, по сравнению с другими
локусами, число которых в отдельных выборках достигало 5 (4 и 5 аллели
были обнаружены в единичных случаях). Наиболее часто встречались
генотипы 11, 13 и 33. Генотипы 12, 14 и 15 встречались редко
(<0,05), а генотипы 22, 44, 55, 24, 25, 35 и 45 отсутствовали.
Иглинская популяция отличалась от прочих частотами аллеля 1 (0,48
против 0,69-0,96) и аллеля 3 (0,48 против 0,02-0,27). Остальные аллели
встречались достаточно редко. Помимо этого иглинская популяция
выделялась по частотам генотипа 11 (0,17 против 0,40-0,80) и генотипа
33 (0,20 – против 0,00-0,08). По частоте генотипа 13
караидельская выборка (0,50) приближалась к иглинской (0,57 против
0,04-0,17 у четырёх оставшихся).
Таким образом,
нами были
получены предварительные результаты по полиморфизму трех
микросателлитных локусов ар243, 4а110 и А8 ядерной ДНК в исследуемых и
сравниваемых выборках пчел. Результаты показывают, что популяции
северной части ареала башкирской пчелы полиморфны по трем
микросателлитным локусам, что характеризует их значительную
генетическую гетерогенность и высокий уровень биоразнообразия.
Полученные результаты будут служить основой для получения основных
генетических характеристик популяций пчел северной части ареала
республики Башкортостан.
Ap243
microsatellite
loci was represented by three alleles 1, 2 and 2. In this case the
maximum rate of 0.80 1 allele was represented in the hybrid Iglinsky
sample, and the rest ranged from 0.42 - 0.58, while the sample had an
intermediate karaidelskaya value of 0.70. In contrast, allele 2 has
been minimal in Iglinsky sample (0.12), and in other varied in the
range of 0,23-0,40. Less often found 3 allele whose frequency in the
studied samples (except Burzyan) generally did not exceed 0.10. In a
sample of the population Burzyan allele 3 was presented with a
frequency of 0.35, which can be assumed as a marker of the southern
Bashkir population. The genotype distribution of the loci showed that
the most represented genotype frequencies between 11 0.29 (Burzyansky)
0.70 (Iglinskiy). Genotype 23 Birsk, karaidelskoy and tatyshlinskoy
populations absent. Hybrid Iglinskiy population is clearly different
from the rest of the genotype frequencies of 11 - 22 genotype and 0.70
- 0.03. Among the remaining also observed some units: Burzyan sampling
frequency allocated 0.26 genotype 33 and Birsk - Mishkinskoye -
karaidelskaya group - in frequency from 0.26 to 0.38 genotype 12.
According to the
analysis of other nuclear marker, microsatellite loci 4a110, it may be
noted that the alleles 1 and 2 were represented in almost equal
proportions, while allele 3 is very rare, or completely absent in the
samples. Most frequent genotypes 11 (0,20-0,60), 22 (0,10-0,28) and 12
(0,30-0,49). The frequency of genotypes 33, 13 and 23 in many samples
was low (<0.05), and some was 0. Iglinskiy Picks distinguished
from
other frequencies of allele 1 (0,45-0,57 at 0.75 against others), and
allele 2 (0.25 vs. 0,43-0,52) and genotype frequencies 11 (0.60 versus
0,20-0,33) and 22 genotype (0.10 vs. 0,20-0,28) . The frequencies of
alleles and genotypes in other samples were approximately equal.
In the study of
microsatellite loci A8 nuclear DNA in the test samples it was detected
bees wider range of alleles, in comparison to other loci in which the
number of individual samples reached 5 (4 and 5 alleles were detected
in a few cases). Most frequent genotypes 11, 13 and 33 genotypes 12,
14, and 15 are rare (<0.05), and genotypes 22, 44, 55, 24, 25,
35
and 45 were absent. Iglinskiy population differed from the other allele
frequencies of 1 (0.48 versus 0,69-0,96) and allele 3 (0.48 versus
0,02-0,27). The rest of the alleles are rare. Besides Iglinskiy
population stood at 11 genotype frequencies (0.17 versus 0,40-0,80) and
genotype 33 (0.20 - against 0,00-0,08). According to the frequency of
the genotype 13 karaidelskaya sample (0.50) approached Iglinsky
(0,04-0,17 at 0.57 against the remaining four).
Thus, we have
obtained
preliminary results of polymorphism of three microsatellite loci ar243,
4a110 A8 and nuclear DNA in the study and compared samples of bees. The
results show that the population of the northern part of the range of
Bashkir bee in three polymorphic microsatellite loci that characterizes
their significant genetic heterogeneity and a high level of
biodiversity. The results will serve as the basis for key genetic
characteristics of populations of bees northern part of the area of
the Republic of Bashkortostan. |
069.
Ilyasov R.A., Komissar A.D., Poskryakov A.V., Nikolenko A.G. Are
Ukrainian bees a separate race? Materials of international conference
Apimondia. Monpellier. 2009. P. 300-302.
ARE
UKRAINIAN BEES A SEPARATE RACE? Ilyasov R., Komissar* A., Poskryakov
A., Nikolenko A. Russia, Institute of genetic and biochemistry , Ufa
(Central Russia) * Ukraine, editor of magazine “The circle of
beekeepers” Ukrainian bee • Disposed in Ukraine and
South–Western
regions of Russia. They also were the main in the forming of so named
Far East population of Russian bees as they were bring to these lands
by migrants from Ukraine in far 19 century. • Old scientific
name of
Ukrainian bees is Apis mellifera acervorum Scorikov • M.Engel
find in
1999 that this name is uncorrect and propose new one Apis mellifera
sossimai Engel 1999 THE NEAREST RELATIVES • It exists several
hypothesis: • 1) “the southern branch of dark forest
Northern European
bees A.m. mellifera” • 2) “the eastern
branch of Central European bees
A.m.carnica”, • 3) “result of long term
mixing of Russian and Middle
European bees” • 4) they belong to Mediterranean
race Apis mellifera
macedonica Ruttner 1988. F.Ruttner hypothesis (1988) Picture 14.1 from
the F. Ruttner book “Biogeography and taxonomy of honey
bees”,1988,
Springer-Verlag (Berlin, New York, London, Paris, Tokyo). •
Names of
countries and Black sea are our. • Apis mellifera macedonica
are
disposed in Northern Greece, Bulgaria, Southern Romania and ???
Ukraine. Migration of bee races to the north and east in the post
Pleistocenic warm period 8-10 000 yeas ago. Arrow of migration
Macedonica bees to modern territory of Ukraine is absent. Information
•
F.Ruttner hadn’t enough material from Ukraine to say, that
Ukrainian
bees are macedonical ones. • He give name macedonica not in
the honour
of small country Macedonia, but in the honour of famous Greece military
leader Alexander Makedonian Wings venation • According DAMINO
analyses,
made in Czech Institute of apiculture in Dol by DR. Kvetoslav Chermak
majority of samples of Ukrainian bees are the same as standard
A.m.macedonica. • The bees from the best of these colonies
were
investigated in Russian genetical centre (city Ufa in Central Russia)
by DR. Ilyasov R., Poskryakov A. and Nikolenko A. Fragment ND2 of
mitochondrial DNK were investigated Results were inserted in GenBank
•
Ilyasov R.A., Komissar A.D., Baymiev A.K., Poskryakov A.V., Nikolenko
A.G. Phylogenetics researches in Apis mellifera macedonica concluded
from mitochondrial DNA sequence , • GenBank. 2006. - accession
numbers
DQ361088-DQ361090. And compare with another results from GenBank
•
Marino A., Mantovani B., Carpana E., Sabatini A.G., Lodesani M. ND2 and
CO1 mitochondrial genes in Apis mellifera
(
) L.: a
molecular approach to Mediterranean populations monitoring // GenBank,
submitted numbers AY114484 - AY136625. 2002. • Arias M.C.,
Sheppard
W.S. Molecular philogenetics of honey bee subspecies (Apis mellifera
L.) inferred from mitochondrial DNA sequence // Molecular philogenetics
and evolution. 1996. V. 5. - V. 3. P. - 557-566 • Franck P.,
Garnery
L., Celebrano G., Solignac M. et al. Hybrid origins of the Italian
honeybees, Apis mellifera ligustica and A.m.sicula // Mol. Ecol. 2000.
V. 9. P. 907-923. This fact contributes to the opinion that: •
Ukrainian bees are not the separate race but they are Ukrainian
population of Macedonian bees. So the F.Ruttner hypothesis is correct.
• Of course, long term adaptation in the climatic condition of
Ukraine
and selection by beekeepers at the last 200 years (one moment from the
point of view of the race evolution) create the population with
characteristics, which differ from the modern bees from the Northern
Greece. • We (A.Komissar, 2005) proposed name Apis mellifera
macedonica
var. ukrainica for the Ukrainian bees. • The scientific name
Apis
mellifera sossimai Engel 1999 can be used for Ukrainian bees before new
argument will be find. VERY INTERESTING AND UBSOLUTELY UNSCIENTIFIC
FACT without explanation • Macedonian bees are disposed in
Northern
Greece, Bulgaria, Macedonia, Part of Serbia, Southern Romania, Ukraine
and Western-Southern region of Russia. • Namely these
countries (and
only these) have orthodox religion . But race of bees lived on the
earth long before forming of different religion. • So it is
possible to
create the unscientific hypothesis about mutual influence of aboriginal
bees to the life of human population. • This hypothesis is
unscientific
absolutely as well as any religion is unscientific also. •
Race of
honeybees Apis mellifera macedonica can be named as race of bees for
the peoples, who practice orthodox religion • See : Komissar
A. Races
of honey bees, human nations and religions. Proceeding of the 3-rd
Europian Congress on Social Insects, St. Petersburg, Russia, 22-27
August 2005, P. 61.
|
068.
Ильясов Р.А., Поскряков А.В., Николенко А.Г. Генетическая
характеристика локальной популяции пчел Альшеевского района Республики
Башкортостан. Материалы Международной научно-практической конференции и
Х зоологической конференции "Проблемы сохранения биологического
разнообразия и использования биологических ресурсов". Минск. 2009. Ч.
1. С. 127-130.
В
работе были взяты локальные популяции пчел трех пасек Альшеевского
района республики Башкортостан, локальная популяция пчел пасеки
Красновишерского района Пермского края, ранее определенная как
популяция A.m.mellifera по результатам анализа локуса COI-COII мтДНК и
двух микросателлитных локусов ap243 и 4a110 (Ильясов с соавт., 2006), и
локальная популяция пчел пасеки Красноуфимского района Свердловской
области, ранее определенная как популяция гибридного происхождения по
результатам анализа локуса COI-COII мтДНК (Ильясов с соавт., 2008).
На основе анализа
полиморфизма локуса COI-COII мтДНК и микросателлитных локусов ap243,
4a110, a24, a8, a43, a113, ap049 яДНК были рассчитаны генетические
расстояния Nei между локальными популяциями. Генетические расстояния
были рассчитаны отдельно по микросателлитным локусам и отдельно с
использованием локусов ядерной и митохондриальной ДНК. Генетические
расстояния были рассчитаны как для каждой пасеки отдельно, так и для
локальной популяции района, включающей все пасеки района. Генетические
расстояния были рассчитаны отдельно по локусам яДНК и совместно с
локусом мтДНК для того, чтобы показать вклад отцовского и материнского
генома.
Генетические
расстояния
по микросателлитным локусам изменяются от 0,069 между пасеками Антипина
Н.Т. д. Поршакова Красновишерского района Пермского края и Ватолина
Г.А. д. Татарский Турыш Красноуфимского района Свердловской области до
0,397 между пасеками Юсуповой Р.А. д. Никифарово Альшеевского района
республики Башкортостан и Селезнева Б.П. п. Раевка Альшеевского района
республики Башкортостан. Генетические расстояния по микросателлитным
локусам и локусу COI-COII мтДНК изменяются от 0,135 между пасеками
Селезнева Б.П. п. Раевка Альшеевского района республики Башкортостан и
Ватолина Г.А. д. Татарский Турыш Красноуфимского района Свердловской
области до 0,613 между пасеками Юсуповой Р.А. д. Никифарово
Альшеевского района республики Башкортостан и Селезнева Б.П. п. Раевка
Альшеевского района республики Башкортостан.
На основе
полученных
генетических расстояний Nei (1987) была построена дендрограмма,
отражающая генетические взаимоотношения локальных популяций, где пасека
Ватолина Г.А. д. Татарский Турыш Красноуфимского района Свердловской
области объединяется с пасекой Селезнева Б.П. п. Раевка Альшеевского
района республики Башкортостан, а пасека Юсуповой Р.А. д. Никифарово
Альшеевского района республики Башкортостан объединяется с пасекой
Антипина Н.Т. д. Поршакова Красновишерского района Пермского края.
Пасека Пискарева М.П. п. Раевка Альшеевского района республики
Башкортостан примыкает на отдаленном расстоянии к последней группе. На
дендрограмме, где рассматривается отдельно локальная популяция пчел
Альшеевского района республики Башкортостан построенной только по
микросателлитным локусам видно, что локальная популяция пчел
Красновишерского района Пермского края и локальная популяция пчел
Красноуфимского района Свердловской области объединяются в одну группу,
тогда как локальная популяция пчел Альшеевского района республики
Башкортостан располагается отдельно. В случае же включения локусов
мтДНК локальная популяция пчел Альшеевского района республики
Башкортостан группируется вместе с локальные популяцией пчел
Красновишерского района Пермского края. Такое расположение можно
объяснить тем, что в локальной популяции пчел Альшеевского района
республики Башкортостан гибридизация шла в большей степени по отцовской
линии, чем по материнской.
В альшеевской
локальной
популяции пчел Ho наблюдаемая гетерозиготность локальные популяции по
данным анализа микросателлитных локусов 0,449 меньше Hs средней
ожидаемой гетерозиготности субпопуляции 0,467 и Ht ожидаемой
гетерозиготности локальные популяции 0,561, что говорит о
незначительном дефиците гетерозигот.
Fis коэффициент
инбридинга особей в субпопуляциях имеет близкое к 0 положительное
значение 0,006, что говорит о незначительности отклонения от равновесия
по Харди Вайнбергу. Fit коэффициент инбридинга субпопуляций также
положителен 0,244, что говорит о некоторой доле инбридинга на уровне
всей локальные популяции. Возможно, что наблюдается эффект Валунда, где
для подразделенной локальные популяции наблюдается инбридинг на
локальные популяционном уровне.
Значение Fst для
всех
микросателлитных локусов 0,244. Это говорит о подразделенности
популяции пчел Альшеевского района, что дает популяции большую
устойчивость. Такое значение Fst отражает 24% различий между пасеками
Альшеевского р-на в среднем.
Наибольший
уровень
генного разнообразия по локусам ap243 и 4a110 со значениями 0,607 и
0,545 соответственно наблюдается в популяции пасеки Антипина Н.Т. д.
Поршакова Красновишерского района Пермского края; по локусу a24 со
значением 0,675 - в популяции пасеки Юсуповой Р.А. д. Никифарово
Альшеевского района республики Башкортостан; по локусу a8 со значением
0,625 - в популяции пасеки Ватолина Г.А. д. Татарский Турыш
Красноуфимского района Свердловской области; по локусу a43 со значением
0,600- в популяциях пасек Юсуповой Р.А. д. Никифарово и Пискарева М.П.
п. Раевка Альшеевского района республики Башкортостан; по локусу a113
со значением 0,600 - в популяции пасеки Пискарева М.П. п. Раевка
Альшеевского района республики Башкортостан, а в остальных популяциях
наблюдалось нулевое значение, за исключением пасеки Юсуповой Р.А. д.
Никифарово Альшеевского района республики Башкортостан; по локусу ap049
со значением 0,550 - в популяции пасеки Юсуповой Р.А. д. Никифарово
Альшеевского района республики Башкортостан.
Таким образом, по
разным
локусам наблюдаются разные результаты, что говорит о независимом
наследовании и разном уровне отбора локусов. Наибольший уровень генного
разнообразия говорит о наибольшем биоразнообразии по данному локусу и
наибольшей устойчивости. Кроме того, наибольший уровень генного
разнообразия свидетельствует и об устойчивом поддержании
биоразнообразия на высоком уровне, что может быть вызвано аутбридингом.
По всем локусам наибольшие уровни генного разнообразия 0,504 и 0,525
наблюдаются в популяциях пасек Юсуповой Р.А. д. Никифарово и Пискарева
М.П. п. Раевка Альшеевского района республики Башкортостан. По районам
наибольшие уровни генного разнообразия со значениями 0,560 и 0,414
наблюдается в популяциях пчел Альшеевского района республики
Башкортостан и Красноуфимского района Свердловской области, что может
быть вызвано процессом гибридизации и разнообразящим отбором в
дальнейшем.
In this paper
were taken
three local populations of bees apiaries Alsheevsky district of the
republic of Bashkortostan, the local population of bees apiary
Krasnovishersky district of the Perm region, previously defined as a
population Ammellifera on the analysis of the locus of mtDNA COI-COII
two microsatellite loci and ap243 4a110 (Ilyasov et al., 2006), and the
local population of bees apiary Krasnoufimsky district of Sverdlovsk
region, previously defined as a population of hybrid origin from the
analysis of the locus of mtDNA COI-COII (Ilyasov et al., 2008).
Based on the
analysis of
polymorphism locus COI-COII mtDNA and microsatellite loci ap243, 4a110,
a24, a8, a43, a113, ap049 nuclear DNA were calculated Nei genetic
distances between the local populations. Genetic distances were
calculated separately for microsatellite loci and loci separately using
nuclear and mitochondrial DNA. Genetic distances were calculated for
each apiary separately and for the local population of the district,
which includes all of the apiary area. Genetic distances were
calculated separately for the loci nDNA together and the locus of mtDNA
to show the contribution of maternal and paternal genome.
Genetic distances
of
microsatellite loci vary from between 0,069 apiaries Antipina NT d.
Porshakova Krasnovishersky district of the Perm region and Vatolina GA
d. Turishev Krasnoufimsky Tatar district of Sverdlovsk region to
between 0,397 apiaries Yusupova RA d. Nikifarovo Alsheevsky district of
the republic of Bashkortostan and Seleznev BP n. Raevka Alsheevsky
district of the republic of Bashkortostan. Genetic distances of
microsatellite loci and the locus of mtDNA COI-COII vary from between
0,135 apiaries Selezneva BP n. Raevka Alsheevsky district of the
republic of Bashkortostan and Vatolina GA d. Turishev Krasnoufimsky
Tatar district of Sverdlovsk region to between 0,613 apiaries Yusupova
RA d. Nikifarovo Alsheevsky district of the republic of Bashkortostan
and Seleznev BP n. Raevka Alsheevsky district of the republic of
Bashkortostan.
On the basis of
genetic
distances Nei (1987) was constructed dendrogram showing the genetic
relationships of local populations where the apiary Vatolina GA d.
Turishev Krasnoufimsky Tatar district of Sverdlovsk region is combined
with the BP apiary Selezneva n. Raevka Alsheevsky district of the
republic of Bashkortostan, and apiary Yusupova RA d. Nikifarovo
Alsheevsky district of the republic of Bashkortostan is combined with
the apiary Antipina NT d. Porshakova Krasnovishersky district of the
Perm region. Apiary Piskareva MP n. Raevka Alsheevsky district adjoins
the Republic of Bashkortostan in the remote distance to the last group.
In the dendrogram, where the local population is considered separately
bees Alsheevsky district of the republic of Bashkortostan built only
microsatellite loci can be seen that the local bee population
Krasnovishersky district of the Perm region and the local population of
bees Krasnoufimsky district of Sverdlovsk region together in one group,
while the local population Bee Alsheevsky district of the republic of
Bashkortostan located separately. In the case of inclusion of mtDNA
loci local bee population Alsheevsky district of the republic of
Bashkortostan is grouped together with the local bee population
Krasnovishersky district of the Perm region. This arrangement may be
explained by the fact that the local bee population Alsheevsky district
of the republic of Bashkortostan hybridization was largely paternal
than maternal.
In Alsheevsky
local bee
population Ho observed heterozygosity local populations by analysis of
microsatellite loci 0.449 less than the average expected heterozygosity
Hs subpopulation 0.467 and Ht expected heterozygosity local populations
0.561, indicating a slight deficit of heterozygotes.
Fis the
inbreeding
coefficient of individuals in subpopulations has close to 0,006 0
positive, indicating that minor deviations from Hardy Weinberg
equilibrium. Fit the inbreeding coefficient is also positive
subpopulations of 0.244, indicating that some fraction of inbreeding at
the level of the entire local populations. It is possible that the
effect observed Valunda, where local populations subdivided inbreeding
observed in the local population level.
Fst value for all
microsatellite loci 0.244. This suggests subdivision bee population
Alsheevsky area, giving a population greater stability. This value Fst
represents 24% difference between apiaries Alsheevsky district average.
The highest level
of
genetic diversity at loci ap243 4a110 and with values 0.607 and 0.545
respectively, observed in the population apiary Antipina NT d.
Porshakova Krasnovishersky district of the Perm region; locus a24 with
the value 0.675 - in the population apiary Yusupova RA d. Nikifarovo
Alsheevsky district of Bashkortostan Republic; locus a8 with a value of
0.625 - in the population apiary Vatolina GA d. Turishev Krasnoufimsky
Tatar district of Sverdlovsk region; locus a43 with a value 0,600-
populations apiaries Yusupova RA d. Nikifarovo and Piskareva MP n.
Raevka Alsheevsky district of the republic of Bashkortostan; locus a113
with a value of 0.600 - in the population apiary Piskareva MP n. Raevka
Alsheevsky district of the republic of Bashkortostan, as observed in
other populations of zero, with the exception of the apiary Yusupova RA
d. Nikifarovo Alsheevsky district of Bashkortostan Republic; locus
ap049 with the value 0.550 - in the population apiary Yusupova RA d.
Nikifarovo Alsheevsky district of the republic of Bashkortostan.
Thus, according
to
various loci observed different results, suggesting independent
inheritance and different levels of selection loci. The highest level
of genetic diversity suggests the greatest biodiversity on the locus
and the greatest stability. In addition, the highest level of genetic
diversity and demonstrates the sustainable maintenance of a high level
of biodiversity that can be caused by outbreeding. For all loci highest
levels of genetic diversity 0.504 and 0.525 observed in populations of
apiaries Yusupova RA d. Nikifarovo and Piskareva MP n. Raevka
Alsheevsky district of the republic of Bashkortostan. In areas of the
highest levels of genetic diversity with the values of 0.560 and
0.414 observed in populations of bees Alsheevsky district of the
republic of Bashkortostan and Krasnoufimsky district of Sverdlovsk
region, which may be caused by the process of hybridization and
diversifying selection in the future.
|
067.
Ильясов Р.А., Николенко А.Г., Поскряков А.В. Новые представления о
филогенетике пчелы вида Apis mellifera L. Материалы Международной
научно-практической конференции "Экология, эволюция и систематика
животных". Рязань. 2009. С. 315-316.
В
работе были использованы пчелы подвида A.m.mellifera из бурзянской и
татышлинской популяций Республики Башкортостан и вишерской и
южно-прикамской популяций Пермского края, которые были ранее выделены
нами на основе изучения полиморфизма межгенного локуса COI-COII мтДНК
(Ильясов с соавт., 2006). Также были использованы пчелы из украинской
популяции с пасеки А.Д.Комиссара под Киевом. Для проведения
секвенционного анализа было взято по три образца из каждой популяции.
При сравнении
нуклеотидной последовательности фрагмента гена ND2 мтДНК уральских и
украинских пчел с последовательностью бурзянской бортевой пчелы
(DQ181611), взятой в качестве референсной, всего наблюдались
нуклеотидные замены в 12 позициях. Между всеми уральскими пчелами
наблюдалось 5 сайтов замен, где замена в позиции 536 Т на С в двух
пчелах DQ181614 и DQ181618 приводила к замене в позиции 12
аминокислотной последовательности Ile на Thr. Украинские пчелы
различались от референсной последовательности сайтами замен в 8
позициях, где замена в позиции 987 являлась трансверсией. Между собой
украинские пчелы практически не различались – наблюдалась
всего
одна замена нуклеотидной последовательности фрагмента гена ND2 мтДНК в
позиции 1099, которая не приводит к заменам в аминокислотной
последовательности.
На основе
сравнительного
анализа нуклеотидной последовательности фрагмента гена ND2 мтДНК пчел
популяций A.m.mellifera на Урале с использованием компьютерной
программы MEGA 3.1 методом кластеризации ближайшего соседа была
построена дендрограмма. На дендрограмме наблюдался низкий уровень
дифференциации представителей разных популяций A.m.mellifera на Урале.
Однако можно отметить, что все три представителя вишерской популяции
(DQ181617-19), а также один представитель южно-прикамской популяции
(DQ181621) все же в некоторой степени отличаются от всех представителей
других популяций Урала, хотя эти различия очень незначительны. Такие
различия представителей вишерской популяции, возможно, являются
результатом длительной изоляции в условиях крайнего севера видового
ареала. Известно, что семьи пчелы из этой популяции
неоднократно
завозились на пасеки юга Пермского края, что и, возможно, объясняло
группировку вместе с пчелами вишерской популяции представителя
южно-прикамской популяции (DQ181621). Большие различия наблюдались
между представителями уральских и украинских популяций, что
обусловлено, несомненно, их принадлежность к разным подвидам -
A.m.mellifera и A.m.macedonica, соответственно.
Для определения
филогенетического паттерна вида A.mellifera и выявления положение в нем
уральских и украинских пчел было проведено сравнение нуклеотидной
последовательности фрагмента гена ND2 мтДНК просеквенированных нами
пчел с последовательностями пчел разных других подвидов A.mellifera,
просеквенированных M.C.Arias, W.S.Sheppard (1996), W.S.Sheppard,
M.D.Meixner (2003). Нуклеотидная последовательность фрагмента гена ND2
мтДНК подвида пчелы A.m.anatoliaca была взята в качестве референсной
последовательности и использована для сравнения с последовательностями
всех образцов пчел. При сравнении секвенсов всех образцов пчел
наблюдались нуклеотидные замены в 28 позициях. Из всех замен 8
относились к трансверсиям, а 20 – к транзициям, что вполне
укладывалось в рамки законов молекулярной эволюции.
На основе
сравнения
нуклеотидных последовательностей с использованием программы MEGA 3.1 и
метода кластеризации ближайшего соседа была построена дендрограмма
генетических отношений подвидов A.mellifera с видами Apis cerana и
Mellipona bicolor, где последние были взяты в качестве внешней группы.
На дендрограмме наблюдалась группировка образцов пчел на четыре
эволюционные ветви, что не противоречило результатам F.Ruttner (1988).
Однако состав этих ветвей отличался от представленного F.Ruttner (1988)
и был в некоторой степени схож с представленными в работе M.C.Arias,
W.S.Sheppard (1996). Однако четыре эволюционные ветви были все же
названы A, M, C и O сходно с F.Ruttner (1988).
Эволюционная
ветвь А
объединяла большинство представителей африканских подвидов пчел. Эта
эволюционная ветвь подразделялась на две группы, одна из которых
объединяла A.m.sahariensis (U35762) и A.m.inermissa (U35751) из
Марокко, A.m.sicula (U35765) с Сицилии и A.m.iberica (U35750) из
Португалии. Другая группа объединяла большинство южно-африканских
подвидов пчел как A.m.adansonii из Нигерии (U35743), A.m.scutellata
(U35764) и A.m.capensis (U35747) из ЮАР, A.m.monticola (U35761) из
Кении и африканизированных пчел из Бразилии (U35745-46). Кроме того,
выделялась еще одна небольшая третья группа африканских пчел,
объединяющая представителей подвидов A.m.scutellata (U35763) из Кении и
A.m.adansonii (U35744) из Сенегала, то есть на территории, огибающей
пустыню Сахара.
Эволюционная
ветвь О
была очень малочисленной и объединяла представителей подвидов A.m.meda
(U35756) и A.m.syriaca (AY618920) из Сирии и A.m.lamarckii (U35753) из
Египта.
Эволюционная
ветвь М
объединяла в основном всех представителей A.m.mellifera уральских
(DQ181611-22) и европейских популяций из Швейцарии (AY114495), Франции
(U35758), Испании (U35759) и Норвегии (U35760). Однако в эту группу
также вошли по два представителя подвидов A.m.sicula (AY114493-94) с
Сицилии и A.m.ligustica (U35752 и AY114490) из Италии, которые попали в
эту группу, возможно, благодаря первоначальной гибридизации с
завезенными туда A.m.mellifera. По нашим данным только A.m.mellifera
является единственным представителем эволюционной ветви М.
Эволюционная
ветвь С
была наиболее многочисленной как по числу подвидов, так и по числу
образцов и объединяла подвиды пчел Средиземноморья, Ближнего Востока и
Кавказа - A.m.ligustica из Италии, A.m.carnica из Германии,
Австрии и Словении, образцы A.m.macedonica из Греции и Украины с пасеки
А.Д.Комиссара проанализированные нами, A.m.cecropia из Греции,
A.m.sicula с Сицилии, A.m.cypria с Кипра, A.m.adami с Крита,
A.m.caucasica с Кавказа, A.m.meda из Сирии, A.m.anatoliaca из Турции,
A.m.syriaca из Сирии и A.m.pomonella с Тянь-Шаня. Однако по составу
подвидов этой эволюционной ветви наблюдались различия с F.Ruttner et
al. (1988), которые относили подвиды A.m.caucasica, A.m.adami,
A.m.cypria, A.m.meda, A.m.anatoliaca и A.m.syriaca к эволюционной ветви
О.
Проведенное
исследование
показало генетическое родство уральских и западноевропейских популяций
A.m.mellifera. Возможно, что подвид A.m.mellifera является единственным
представителем внутривидовой эволюционной ветви М, в которую, таким
образом, не следует включать не только африканские подвиды Apis
mellifera sahariensis и Apis mellifera intermissa, но и испанский
подвид Apis mellifera iberica, что противоречит гипотезе F.Ruttner
(1988). Показано, что предковой формой вида Apis mellifera L., могли
быть пчелы эволюционной ветви С, а не О, как считал ранее F.Ruttner
(1988). Результаты анализа украинских пчел, подтвердили их
принадлежность к подвиду A.m.macedonica. Было подтверждено, что подвиды
A.mellifera подразделяются на 4 эволюционные ветви, а не 3, как считали
ранее.
We used bee
subspecies
of Ammellifera Burzyan tatyshlinskoy populations and the Republic of
Bashkortostan and Visherskaya Kama region and southern populations of
the Perm region, which had previously been allocated on the basis of
our study of polymorphism of the intergenic locus COI-COII mtDNA
(Ilyasov et al., 2006). Bees were also used from the Ukrainian
population from the apiary A.D.Komissara near Kiev. To perform the
analysis were taken sekventsionnogo Three samples of each population.
When comparing
the
nucleotide sequence of the gene fragment ND2 mtDNA Ural and Ukrainian
bees sequence Burzyan wild-hive bee (DQ181611), taken as a reference,
the entire nucleotide substitutions were observed at 12 positions.
Between all the Ural bees observed 5 sites replacements where the
replacement at position 536 T to C in two bees DQ181614 and DQ181618
leads to the substitution at position 12 in the amino acid sequence Ile
Thr. Ukrainian bees differ from the reference sequence sites
substitutions in 8 positions where substitution at position 987 was
transversions. Between a Ukrainian bees practically identical - there
was only one replacement of the nucleotide sequence of a gene fragment
ND2 mtDNA positions in 1099, which does not lead to substitutions in
the amino acid sequence.
On the basis of a
comparative analysis of the nucleotide sequence of a gene fragment ND2
mtDNA bee populations in the Urals Ammellifera using a computer program
MEGA 3.1 by nearest neighbor clustering dendrogram was constructed. In
the dendrogram observed low level of differentiation of representatives
of different populations Ammellifera the Urals. However, it should be
noted that all three members of the population Visherskaya
(DQ181617-19), as well as one representative of the population of
South-Kama region (DQ181621) is still somewhat different from all other
representatives of the Urals populations, although these differences
are very minor. Such differences representatives Visherskaya
populations are probably a result of long-term isolation in the Far
North of the species range. It is known that the family of bees this
population often imported apiary on the south of the Perm region, and
that may explain the grouping together with bees Visherskaya population
representative of the population of the South-Kama region (DQ181621).
Large differences were observed between the Ural and Ukrainian
population, due, no doubt, they belong to different subspecies -
Ammellifera and Ammacedonica, respectively.
To determine the
phylogenetic species A.mellifera pattern and identify its position in
the Ural and Ukrainian bees were compared the nucleotide sequence of
the gene fragment sequenced mtDNA ND2 our bees with different sequences
of other subspecies of bees A.mellifera, sequenced MCArias, WSSheppard
(1996), WS Sheppard, MDMeixner (2003). The nucleotide sequence of a
gene fragment ND2 mtDNA bee subspecies Amanatoliaca was taken as a
reference sequence, and used for comparison with the sequences of all
the samples of bees. When comparing all samples Sequence bees observed
nucleotide substitutions in 28 positions. Of the 8 substitutions
treated transversions and 20 - to the transitions that fits into the
framework of the laws of molecular evolution.
Based on a
comparison of
the nucleotide sequences using the program MEGA 3.1 and the nearest
neighbor clustering method was constructed dendrogram of genetic
relationship subspecies A.mellifera overlooking Apis cerana and
Mellipona bicolor, where the latter have been taken as an outgroup. In
the observed dendrogram grouping samples of bees into four evolutionary
branch that does not contradict the results of F.Ruttner (1988).
However, the composition of these branches differ from the F.Ruttner
(1988) and was somewhat similar to that shown in MCArias, WSSheppard
(1996). However, four evolutionary branches were still named A, M, C
and O is similar to F.Ruttner (1988).
Evolutionary
branch A
united the majority of the African subspecies of bees. This
evolutionary branch was divided into two groups, one of which is united
Amsahariensis (U35762) and Aminermissa (U35751) from Morocco, Amsicula
(U35765) with Sicily and Amiberica (U35750) from Portugal. Another
group unites the majority of the South African subspecies of bees as a
Amadansonii Nigeria (U35743), Amscutellata (U35764) and Amcapensis
(U35747) from South Africa, Ammonticola (U35761) from Kenya and
Africanized bees in Brazil (U35745-46). Furthermore, stood another
small third group of African bees, uniting representatives of
subspecies Amscutellata (U35763) from Kenya and Amadansonii (U35744)
from Senegal, that is the territory of the envelope Sahara Desert.
On the
evolutionary
branch it is very small and has united representatives of subspecies
Ammeda (U35756) and Amsyriaca (AY618920) from Syria and Amlamarckii
(U35753) from Egypt.
The evolutionary
branch
of M united mainly of representatives of the Ural Ammellifera
(DQ181611-22) and European populations from Switzerland (AY114495),
France (U35758), Spain (U35759) and Norway (U35760). However, this
group also includes two representatives subspecies Amsicula
(AY114493-94) from Sicily and Amligustica (U35752 and AY114490) from
Italy, who are in this group, probably due to the initial hybridization
with importations to Ammellifera. According to our data only
Ammellifera the sole representative of the lineage M.
With evolutionary
branch
was the most numerous in both the number of subspecies, and the number
of samples and bee subspecies united Mediterranean, the Middle East and
the Caucasus - Amligustica from Italy, Amcarnica from Germany, Austria
and Slovenia, Ammacedonica samples from Greece and Ukraine in the
apiary A.D.Komissara analyzed by us, Amcecropia from Greece, Amsicula
from Sicily, Amcypria Cyprus, Amadami Crete, Amcaucasica the Caucasus,
Ammeda Syria, Amanatoliaca from Turkey, Amsyriaca from Syria and
Ampomonella with the Tien Shan. However, the composition of the
sub-species evolutionary branch observed differences F.Ruttner et al.
(1988), which refers subspecies Amcaucasica, Amadami, Amcypria, Ammeda,
Amanatoliaca and Amsyriaca to evolutionary branch O.
The study showed
the
genetic relationship of the Urals and Western European populations
Ammellifera. Perhaps Ammellifera subspecies is the only representative
of intraspecific evolutionary branches M, which thus should not be
included not only African subspecies Apis mellifera sahariensis and
Apis mellifera intermissa, but Spanish subspecies Apis mellifera
iberica, which contradicts the hypothesis F.Ruttner ( 1988). It is
shown that the ancestral form of the type Apis mellifera L., could be
evolutionary branch with bees, and not, as previously thought F.Ruttner
(1988). The results of the analysis of Ukrainian bees, have confirmed
that they belong to the subspecies Ammacedonica. It was confirmed that
the subspecies A.mellifera divided into 4 evolutionary branches, not 3,
as previously thought.
|
066.
Колбина Л.М., Непейвода С.Н., Ильясов Р.А., Николенко А.Г., Поскряков
А.В. Генетический анализ популяции пчел Западного Предуралья и
Республики Башкортостан. Материалы Международной научно-практической
конференции "Зоотехническая наука на удмуртской земле. Состояние и
перспективы". Ижевск. 2009. С.49-55.
Рассмотрены
две популяции пчёл Западного Предуралья и Республики Башкортостан. По
результатам анализа ядерной и митохондриальной ДНК на территории
Западного Предуралья распространена генетически подразделенная
популяция пчёл среднерусской породы, частично гибридизированная с
подвидами из южных регионов. Проведен сравнительный анализ популяций
пчел Западного Предуралья с популяцией пчел среднерусской расы
A.m.mellifera Бурзянского района и гибридной популяцией Иглинского
района Республики Башкортостан. В исследованиях использовался анализ
межгенного локуса COI-COII мтДНК и микросателлитный локус 4а110 яДНК.
По результатам исследований выявлены частоты встречаемости двух видов
аллелей микросателлитного локуса 4а110 ядерной ДНК и межгенного локуса
COI-COII митохондриальной ДНК. Исходя из вышеприведенной частоты, легко
вычислить ожидаемую встречаемость генотипов микросателлитного локуса
4а110 ядерной ДНК при условии случайного смешивания. Однако
исследования показали, что реальная картина частот встречаемости
генотипов отличается от ожидаемой. В некоторых случаях очень
значительно, особенно у Глазовской и Камбарской популяций. В то же
время частота встречаемости генотипов Шарканской популяции практически
соответствует ожидаемой. Частота встречаемости генотипов межгенного
локуса COI-COII митохондриальной ДНК равна частоте встречаемости
аллелей. Для любого локуса генетическое разнообразие является
вероятностью того, что две аллели, случайным образом выбранных в
популяции, будут отличаться друг от друга. Если генное разнообразие
микросателлитного локуса 4а110 ядерной ДНК большое у всех изученных
популяций, то генное разнообразие межгенного локуса COI-COII
митохондриальной ДНК в большинстве случаев невысоко, в нем лидирует
Бурзянская популяция, чуть меньшее разнообразие в Шарканской и
Завьяловской популяции, а в Глазовской и Мож- гинской популяции все
изученные образцы по межгенному локусу COI-COII митохондриальной ДНК
принадлежат к одному генотипу. В дальнейшем были рассчитаны
коэффициенты генетической дифференциации Fst для уральских популяций
совместно по анализу микросателлитного локуса 4а110 ядерной ДНК и
межгенного локуса COI-COII митохондриальной ДНК. Значение коэффициента
дифференциации Fst колеблется от 0,011 до 0,422, что в большинстве
случаев позволяет утверждать о наличии статистически значимой
дифференциации популяций пчел. Генетические расстояния, рассчитанные с
помощью анализа частот аллелей межгенного локуса COI-COII
митохондриальной ДНК, были в пределах от 0,000 до 0,966. В отличие от
результатов, полученных с помощью изучения микросателлитного локуса
4а110 ядерной ДНК, эти данные говорят о гораздо большей дистанции между
популяциями пчел. Особенно далеко отстоит от других Завьяловская
популяция, пределы генетических расстояний между ней и остальными
популяциями колеблются в пределах от 0,133 до 1,151, что демонстрирует
очень значительные различия в происхождении этих популяций. При
графическом отображении генетической дифференциации популяций на основе
полученных генетических расстояний (D) Nei микросателлитного локуса
4а110 ядерной ДНК легко заметить, что Глазовская популяция наиболее
удалена от других популяций, тогда как между остальными не обнаружено
статистически значимой генетической дифференциации. При графическом
отображении генетической дифференциации популяций на основе полученных
генетических расстояний (D) Nei межгенного локуса COI-COI1
митохондриальной ДНК наблюдается принципиально иная картина. Четко
обособлена от остальных популяций пчел Завьяловская. Кроме того,
выделяются две четкие группы популяций, в одну входят Иглинская и
Шарканская популяции, а во вторую Бурзянская, Камбарская,
Мало-Пургинская, Глазовская и Можгинская популяции. Внутри двух
выделенных групп популяций не удалось обнаружить статистически значимую
генетическую дифференциацию. При графическом отображении генетической
дифференциации популяций на основе совместного анализа генетических
расстояний (D) Nei как икросателлитного локуса 4аП0 ядерной ДНК, так и
межг енного локуса COI-COII митохондриальной ДНК наблюдается картина,
схожая с предыдущей. Четко обособлена Завьяловская популяция пчел,
остальные популяции разделяются на две достоверно отличающиеся друг от
друга группы, внутри которых не наблюдается статистически значимой
генетической дифференциации. Таким образом, по результатам анализа
ядерной и митохондриальной ДНК на территории Западного Предуралья
наблюдается генетически подразделенная популяция пчел среднерусской
расы, частично гибридизированная с подвидами из южных регионов. Очень
небольшой объем выборки позволяет делать только предварительные выводы.
We examined two populations of bees and of the West Urals
Bashkortostan. According to the analysis of nuclear and mitochondrial
DNA in the West Urals common genetic subdivision Central Russian breed
of bees population, partly hybridized a subspecies of the southern
regions. A comparative analysis of bee populations West Ural region
with a population of bees of Central race Ammellifera Burzyansky
district and hybrid populations iglinsky district Republic of
Bashkortostan. The study used the analysis of intergenic locus COI-COII
mtDNA and nuclear DNA microsatellite loci 4a110. According to the
research revealed the frequency of occurrence two kinds of alleles of
microsatellite loci 4a110 nuclear DNA intergenic locus COI-COII
mitochondrial DNA. Based on the above frequency, it is easy to
calculate the expected genotypes of microsatellite loci 4a110 Nuclear
DNA provided accidental mixing. However, studies have shown that the
real picture of the frequency of occurrence of genotypes It is
different from the expected. In some cases, very significant,
especially in the Glazov and Kambarka populations. In the same time
frequency of genotypes Sharkan population almost It corresponds to the
expected. The frequency of genotypes intergenic locus COI-COII equal to
the frequency of mitochondrial DNA alleles. For each locus, genetic
diversity is likely that the two alleles in a randomly selected
population will differ from each other. If genetic diversity
microsatellite loci 4a110 nuclear DNA in all large populations studied,
the genetic diversity intergenic locus COI-COII mtDNA in most cases, is
low, it leads Burzyan population slightly smaller variety in Sharkan
and Zavyalovsky population, and in the Glazov and one can ginskiT
population of all the studied samples of intergenic locus COI-COII
mitochondrial DNA belong to the same genotype. In the future, genetic
factors were calculated Fst differentiation for the Ural population
together Analysis microsatellite loci 4a110 nuclear DNA and the
intergenic locus COI-COII mitochondrial DNA. The coefficient Fst
differentiation ranges from 0.011 to 0.422, in most cases, suggests the
presence of a statistically significant differentiation of bee
populations. Genetic distances calculated using frequency analysis
alleles intergenic locus COI-COII mitochondrial DNA, They ranged from
0.000 to 0.966. In contrast to the results obtained by studying nuclear
microsatellite loci 4a110 DNA, these data suggest a much greater
distance between populations bees. Especially far from other
Zavyalovsky population, limits genetic distances between it and the
rest populations ranged from 0.133 to 1.151, which demonstrates very
significant differences in the origin of these populations. In the
graphical display of genetic differentiation population based on
genetic distances obtained (D) Nei microsatellite loci 4a110 nuclear
DNA is easy to see that Glazovskaya population is furthest from the
other populations, then both among the other found no statistically
significant genetic differentiation. In the graphical display of
genetic differentiation population based on genetic distances obtained
(D) Nei intergenic locus COI-COI1 mitochondrial DNA is observed
radically different picture. Clearly separated from the rest of the
population Zavyalovsky bees. Furthermore, it identifies two distinct
groups populations, one includes Iglinskiy and Sharkan population and
the second Burzyan, Kambarka, Little Purginskaya, Glazovskaya and
Mozhginsky population. Within two selected population groups could not
find a statistically significant genetic differentiation. In the
graphical display of genetic differentiation populations on the basis
of a joint analysis of genetic distances (D) Nei like ikrosatellitnogo
locus 4aP0 nuclear DNA and the inter-tary locus COI-COII mitochondrial
DNA is observed picture, similar to the previous one. Clearly separated
Zavyalovsky population bees, other populations are divided into two
significantly different from each other group, which is not observed in
statistically significant genetic differentiation. Thus, according to
the analysis of nuclear and mitochondrial DNA in the West Urals been
genetically subdivided population of bees of Central race, partly
hybridized with a subspecies of the southern regions. Highly small
sample size allows only preliminary findings. |
065.
Kolbina L.M., Nepeivoda S.N., Ilyasov R.A., Poskryakov A.V., Nikolenko
A.G. Comparing the methods of race determination bee-colonies under
global crossbreeding of bees. Materials of international conference
"XLVI Naukowa konferencja pszczelarska". Pulawy. 2009. P. 37-38.
In
our research
the sample of 63 bee-families of 11 apiaries of 6 regions of Udmurtia
Repablic was used. In this research we used morphometric and genetic
methods. Genetic research was carried out in common with institute of
biochemistry and genetics of Ufa scientific center Russian Academy of
Sciences. The basis of genetic analysis was the polymorphism of
intergenic locus COI-COII of different races of bees (table 1).
The results of both methods coincided more than by 66% in Mozhginskiy
region, in diametrical opposition with Sharkanskiy region. This allows
to choose confidently only the one population of A.m. silvanium that
habits in Mozhginskiy region, all other bees were strongly crossbreeded.
Besides all its advantages, genetic method has serious weakness. The
native race of the bees of Udmurtia Republic is Apis mellifera
mellifera, and brought bee-families of other races were the small part
in general bees of Udmurtia Republic. In result the most part of
crossbreeding of bee-families was from the male line, which genetic
method can not consider. On other hand, high variability of
morphological characteristics, that appear as results of global
crossbreeding, leaded to the effect that some of hybrid bee-families
have figure of A.m. mellifera race. Therefore, reliable results can be
obtained only by using both morphological and genetic methods of
analysis.
|
064.
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Investigations of
population Apis mellifera mellifera L. from Burzyan district of
Bashkortostan on Southern Urals. Materials of international conference
"XLVI Naukowa konferencja pszczelarska". Pulawy. 2009. P. 41-42.
Our
earlier researches was shown that bashkir bees (bees from Bashkortostan
republic of Russia) on taxonomy behaved to the subspecies of
A.m.mellifera. Originally one unique place where conservation clean
strains of this bee considered a small region on the south of
Bashkortostan in national park “Shulgan-Tash”. The
task of
our research is the study bees population on south part of natural area
of bashkir bees.
Bees were selected from 5 places: village Starosubkhangulovo, village
Novomusyatovo, village Irgyzly of Burzyanskii district, village Krutoi
log of Аbzelylovskii district, village Syuren Кugarchynskii district of
Bashkortostan. In research were used: locus COI-COII mtDNA, 4
microsatellite locuses ap243, 4a110, a8, a43 of nuclear DNA. We
calculated frequencies of alleles of every locuses. Frequencies of
combination PQQ (marker of A.m.mellifera) of intergenic locus COI-COII
mtDNA in all bees populations were with frequency 1.0, while in Syuren
there haven’t it. For receiption of information about
distributing of southern bashkir bee population is necessary to get
frequencies of all alleles and genetic distances between local
populations.
Maximal distances is observed between populations Syuren and Krutoi
log. Minimal distances – between populations Krutoi log and
Novomusyatovo. Such grouping agreed both geographical location and
genetic composition of these population. In cluster analysis by
neighbour joining method population of Syuren disposed apart from all
because hybrid colonies of bees are represented here mainly. Picture of
cluster analysis can reflect some degrees the levels of migrations
between populations where most close located population will be
closely-related genetically also. Thus, our conducted researches allow
to make conclusion that natural area of Burzyan population (bees
population in Burzyanskii district) of bashkir bees A.m.mellifera,
possibly has expansion to east direction to Аbzelylovskii district,
while to a south to Кugarchynskii district it hasn’t
expansion.
|
063.
Шареева З.В., Ильясов Р.А., Кутлин Н.Г., Поскряков А.В., Николенко А.Г.
Пчела подвида Apis mellifera mellifera L. на Cевере республики
Башкортостан // Ученые записки Казанской государственной академии
ветеринарной медицины им. Н. Э. Баумана. Серия. Естественные науки.
2008. Т. 195. С. 245-249.
Проблема
гибридизации темной лесной пчелы с южными подвидами и сохранение
генофонда среднерусских пчел Apis mellifera mellifera L. является
основной в развитии пчеловодства России уже более полувека. В настоящее
время для их решения применяются как классические (анализ
фенотипических признаков – экстерьерные, морфологические,
хозяйственно-полезные, поведенческие) (надо все убрать, т.к. уже есть в
начале), так и современные молекулярно-генетические методы
идентификации расовой принадлежности медоносных пчел, что значительно
повысило эффективность анализов при высоком количестве гибридных семей.
Исследуемые нами районы также попали под массовый эксперимент по
гибридизации, который преследовал цель – улучшение
хо-зяйственнополезных признаков местных пчел. Полученные нами
результаты позволяют утверждать , что в данных популяциях
произошел процесс самовосстановления исходного генофонда, что в свою
очередь свидетельствует о большей приспособленности к местным условиям
(надо заменить на следствием чего является высокий уровень
приспособленности к местным условиям Южного Урала). Мы предполагаем,
что процесс восстановления аборигенного генофонда мог произойти
благодаря комплексному воздействию факторов окружающей среды, таких как
природно-климатические, антропогенные, биогеоценотические и др.
Естественно, что восстановление не могло бы произойти в случае, если
генофонд местных пчел был бы полностью уничтожен. В данном случае
произошел клас-сический процесс борьбы за существование, результатом
чего стало вытеснение наименее приспособленных генотипов. Следует
отметить, что генофонд современных пчел этого региона не остался
прежним, а подвергся некоторым модификациям, существенно не влияющим на
об-щий уровень приспособленности.
Выводы и
предложения
Таким образом,
выдвинутая нами гипотеза о возможном более ши-роком распространении
ареала популяции Apis mellifera mellifera L. подтвердилась высокими
результатами частоты (надо заменить на по результатам частоты)
встречаемости комбинации PQQ у пчел исследуемых районов. Поскольку с
момента повсеместной гибридизации прошло уже более полувека (надо
заменить на более пятидесяти лет), очевидно, изучаемые нами популяции
пчел восстановили свой исходный генофонд.
В настоящее время
нами
проводятся сравнительные популяционно-генетические исследования на
основе полиморфизма микросателлитных локусов ядерного генома пчел. Мы
предполагаем, что сходные результаты можно получить и по популяциям
пчел других северных районов Республики Башкортостан, что может явиться
целью наших дальнейших исследований.
The problem
hybridization dark forest bees with the southern subspecies and
preserve the gene pool of the Central Russian bee Apis mellifera
mellifera L. is the main development of beekeeping Russia for more than
half a century. Currently, their solutions are used both classic
(analysis of phenotypic traits - exterior, morphological, economically
useful, behavioral) (everything must be clean, as is already in the
beginning) and modern molecular genetic methods for identification of
race honey bees, which greatly increased the efficiency of analyzes
with high number of hybrid families. We investigated areas also came
under a massive experiment on hybridization, which was aimed at -
improving ho zyaystvennopoleznyh signs of local bees. Our results
suggest (should be changed to assume) that occurred in these
populations of the recovery process (it is necessary to put the renewal
of the) of the original gene pool, which in turn indicates a greater
adaptability to local conditions (to be replaced by resulting in a
higher level of fitness to the local conditions of the Southern Urals).
We assume that the process of restoring native gene pool could occur
due to the combined effect of environmental factors, such as climatic,
anthropogenic, biogeocenotic and others. Of course, that recovery might
not happen if the gene pool of native bees would have been completely
destroyed. In this case, there was a class-rescattering of the process
of the struggle for existence, which resulted in the ousting of the
least adapted genotypes. It should be noted that the gene pool of
modern bees in this region has not remained the same, but has undergone
some modifications do not affect the overall level of fitness,.
Conclusions and
suggestions
Thus, we put
forward the
hypothesis of a possible dissemination of the SI-rock area populations
Apis mellifera mellifera L. results confirmed the high frequency (to be
replaced by the results of the frequency) of occurrence of the
combination of PQQ bees studied areas. Because since the widespread
hybridization has been more than half a century (to be replaced by more
than fifty years), it is obvious we are studying bee population
regained its original gene pool.
Currently, we
carry out
a comparative population genetic studies based on polymorphism of
microsatellite loci of the nuclear genome of bees. We believe that
similar results can be obtained on populations of bees other northern
areas of the Republic of Bashkortostan, which may be the aim of our
further research. |
062.
Fahretdinova S.A., Ilyasov R.A., Poskryakov A.V., Nikolenko A.G.
Prospects of wild bee populations preservation of burzyan districts in
bashkortostan apis mellifera mellifera L. Materials of IV international
conference of young scientists “Biodiversity. ecology.
adaptation. evolution”. Odessa. 2009. C. 96.
The
area of a honeybee of subspecies Apts mellifera mdlijera L ( A bee of
Middle Russian race) distribution covered extensive territory from the
Britain to the Urals, along the northern border of the distribution of
this species. Evolution of this subspecies took place in severe
environmental conditions and as a result il has got the properties
which have provided advantages over other subspecies. Throughout the
XX-th century the area of Apis mellifera mellifera subspecies reduced
as a result of hybridization with ofher subspecies. Several populations
of Apis melufem mellifera are known in the Urals. In Bashkiria it is
northern and southern (burzjanski) populations. Burzjan population is
unique because it is rather large in size, it is highly isolated and is
less subjected to anthropogenous influences.
Besides,
cultivation of
wild bees in Burzjansky area is preserved Bees population from apiaries
plays a great role in wild bees preservation. There is constant
exchange Between wild bees and bees from apiaries Population ot wild
bees replenishes at the expense of bees from apiaries.
The example of
South
Ural forest reserve demonstrated that the оi.-.appearance of villages
was followed bv wild bees. Therefore, to guarantee preservation of wild
bees population, it is necessary to study genetic processes not only on
the territory of forest reserve ^Shulgan-Tash» (where all the
researches were mainly carried out). It is very important to
investigate the population of the wnole this area. |
061.
Ilyasov R.A., Poskryakov A.V., Nikolenko A.G. Population genetics
analysis of bees from populations of Ural and Volga regions. Materials
of IV international conference of young scientists
“Biodiversity. ecology. adaptation. evolution”.
Odessa. 2009. C. 99-100.
In
Bashkortostan republic there is very hard problem of conservations of
aboriginal bee subspecies A.m.mellifera. For conservations it is
necessary identification hybrid families, to eliminate their
further distribution. Intergenic locus COI-COII of mtDNA varying among
bees subspecies. There are the genetic markers of this locus allowing
identify of hybrid origin bees colonies, in particular hybridization
with bees from Caucasus (A.m.caucasica and A.m.armeniaca). In
Bashkortostan republic we shown existence pool of the saved aboriginal
bees in the north of republic on territory of several districts
(Тatyshlynski, Birski, Кaraidelski, Мishkinski, Buraevski and Аskinski)
and in the south of republic on territory of Burzyan district.
We
studied
populations of bees on territory of several regions of Ural and Volga
region. Large populations of bees A.m.mellifera on our researches was
saved on territory of Permski oblast, Bashkortostan republic and
republic Udmurtiya. The higher degree of hybridization is observed in
bee population on territory of the Chelyabynski and Sverdlovski oblast.
On the basis of the conducted researches it is already possible to make
the map of geographical distribution of natural area of aboriginal bee
A.m.mellifera.
Genetic
relatedness of A.m.mellifera populations we show using nuclear DNA
locuses, in particular microsatellites ap243, 4a110, ap049, a113, a43,
a8. On the grouping of population influences both community of their
origin and their geographical location in relation to each other.
Cluster analysis was conducted using neighbour joining method. On built
dendrogram Bee population of Iglinski district grouping separately from
other populations of Bashkortostan republic. On dendrogram bee
populations of different regions (Bashkortostan republic, Permski
oblast, republic Udmurtiya and Sverdlovskaya oblast) population of bees
of Sverdlovskaya oblast is disposed separately. Such separate location
of bees population of Iglinski district of Bashkortostan republic and
Sverdlovskaya oblast is explained by their hybrid origin. Our
laboratory plans to extend genetic researches of bees populations on
territory of Russia and also countries of CIS. |
060.
Шареева З.В., Ильясов Р.А., Кутлин Н.Г., Поскряков А.В., Николенко А.Г.
Изучение генетической структуры северной части ареала башкирской
популяции Apis mellifera mellifera L. Вестник Оренбургского
государственного университета. 2009. № 6 (100). С. 427-428.
Изучение
генетической структуры северной части ареала башкирской популяции Apis
mellifera mellifera L. (The study of the genetic structure of the
northern part of the area of the Bashkir population of Apis mellifera
mellifera L.)
Нами был изучен
уровень
генетического разнообразия северной части ареала башкирской популяции
A.m.mellifera на основе F-коэффициентов и гетерозиготности,
рассчитанных по данным частот аллелей и генотипов микросателлитных
локусов ap243, 4a110 и А8 ядерной ДНК.
We have studied
the
level of genetic diversity northern part of the area of the Bashkir
population Ammellifera based on F-ratio and heterozygosity calculated
according to the allele and genotype frequencies of microsatellite loci
ap243, 4a110 A8 and nuclear DNA.
Publication Name:
Shareeva ZV, Ilyasov R.A., Kutlin NG, Poskryakov A.V. Nikolenko A.G.
The study of the genetic structure of the northern part of the area of
the Bashkir population of Apis mellifera mellifera L. Bulletin of the
Orenburg State University. 2009. V. 6 (100). P. 427-428.
|
059.
Ильясов
Р.А., Шареева З.В., Поскряков А.В., Николенко А.Г. Сравнительный анализ
нуклеотидной последовательности фрагмента гена ND2 мтДНК в популяциях
пчел республики Башкортостан. Вестник Оренбургского государственного
университета. 2009. № 6 (100). С. 155-156.
Сравнительный
анализ нуклеотидной последовательности фрагмента гена ND2 мтДНК в
популяциях пчел республики Башкортостан (Comparative analysis of the
nucleotide sequence of the gene fragment ND2 of mtDNA in populations of
bees of the republic of Bashkortostan)
В статье
приводятся
результаты сравнительного анализа нуклеотидной последовательности
фрагмента гена ND2 мтДНК пчел Бирского района и пчел A.m.mellifera и
A.m.caucasica. Кластерный анализ показал большее сходство пчел бирской
популяции с A.m.mellifera, чем с A.m.caucasica.
The article
presents the
results of a comparative analysis of the nucleotide sequence of the
gene fragment of mtDNA ND2 bees and bees Birsky District Ammellifera
and Amcaucasica. Cluster analysis showed greater similarity with the
populations of bees Birsk Ammellifera, than Amcaucasica.
Publication Name:
Ilyasov R.A., Shareeva ZV, Poskryakov A.V. Nikolenko A.G. Comparative
analysis of the nucleotide sequence of the gene fragment ND2 of mtDNA
in populations of bees of the republic of Bashkortostan. Bulletin of
the Orenburg State University. 2009. V. 6 (100). P. 155-156. |
058.
Ильясов
Р.А.,
Поскряков А.В., Николенко А.Г. Экспериментальные исследования пчел
Урала и Поволжья. Экологический мониторинг и биоразнообразие. 2009. № 4
(1-2). С. 61-62.
Экспериментальные
исследования пчел Урала и Поволжья (Experimental studies of bees of
Urals and the Volga region) Самым новым и многообещающим методом
генетической анализа пчел является изучение полиморфизма SNP, на основе
чего можно будет составить генетический паспорт пчелы, очень быстро и
дешево определить подвидовую принадлежность пчел и филогенетический
паттерн. На сегодняшний день для медоносной пчелы известно несколько
тысяч SNP (Whitfield et al., 2006). Изучение генетической
вариабельности в популяции пчел Урала и Поволжья было выполнено нами с
использованием порядка 10 генетических маркеров. Оказалось, что пчелы
не по всем маркерам обладают значительным полиморфизмом. Так
микросателлитный локус ар049 в популяции пчел Башкортостана обладал
очень незначительным полиморфизмом и в дальнейшем не был использован.
Значительным полиморфизмом обладали микросателлитные локусы - ар243,
4al 10, А8, А113 ядерной ДНК. Очень интересный полиморфизм наблюдался у
меж- генного локуса COI-COII мтДНК, где мы обнаружили существование 4
гаплотипов (Q, PQ, PQQ и PQQQ). Кроме того, в популяции пчел Урала и
Поволжья полиморфным является ген антибактериального пептида дефензина
(Львов, 2002) ядерной ДНК. Оказалось, что для большинства популяций
пчел, где не происходит массовый ввоз семей, наблюдается некоторая доля
инбридинга, тогда как в популяциях, в которые завозят пчел извне,
наблюдается аутбридинг. The newest and most promising method Genetic
analysis is the study of bees polymorphism SNP, on the basis of which
can be make genetic passport bees, very quickly and cheaply identify
subspecies bees and phylogenetic pattern. To date, for the honeybee
several thousand known SNP (Whitfield et al., 2006). The study of
genetic variability in bee population of the Urals and the Volga region
was carried out us with the order of 10 genetic markers. It was found
that the bees not all markers have significant polymorphism. So
microsatellite loci ar049 in the population of bees Bashkortostan had a
very slight polymorphism and subsequently was not used. considerable
polymorphism had microsatellite loci - Ar243, 4al 10, A8, A113 nuclear
DNA. very Much interesting polymorphism observed in inter- gene locus
COI-COII mtDNA where we found the existence of four haplotypes (Q, PQ,
PQQ and PQQQ). Furthermore, in the bee population Urals and the Volga
is a polymorphic gene defensin antimicrobial peptides (Lviv, 2002) of
nuclear DNA. It turned out that for most bee populations where there is
no mass import families, there is some share of inbreeding, whereas in
populations in which bees are imported from outside, there is
outbreeding. Publication Name: Ilyasov RA, Poskryakov AV, Nikolenko AG
Experimental studies of bees of Urals and the Volga region.
Environmental monitoring and biodiversity. 2009. V. 4 (1-2). P. 61-62. |
057.
Ильясов
Р.А., Поскряков А.В., Николенко А.Г. Внутривидовая подразделенность
медоносной пчелы вида Apis mellifera L. Материалы международной научной
конференции "Синтетическая теория эволюции: состояние, проблемы,
перспективы". Луганск. 2009. С. 32-34.
Вид
Apis mellifera L. занимал обширный ареал, включающий Африку, Европу и
Ближний Восток. В последнее время в результате антропогенной
деятельности возникли гибридные популяции, далеко отстоящих друг от
друга популяций, которые в естественных условиях не встречаются друг с
другом.
В результате
морфометрических исследований F.Ruttner (1992) выделил 25 подвидов Apis
mellifera L. (см. рис.) Большое число подвидов обусловлено,
по-видимому, изоляцией и последующим накоплением генетических различий.
В Европе такая изоляция могла возникнуть в результате оледенения в
Плейстоценовый период (Ruttner, 1992). В Африке изоляция, возможно,
происходила в результате процессов опустынивания, а также наличия
естественных преград в виде горно-лесных массивов. Так, A.m.sahariensis
была изолирована процессами опустынивания, а A.m.monticola –
горно-лесными массивами (Arias, 1996). F.Ruttner с соавт. (1978)
морфометрическими исследованиями показали разделение Apis mellifera L.
на четыре подвидовые группы: A, M, C и O.
Группа А,
включала
африканские подвиды: A.m.lamarckii, A.m.yemenitica, A.m.litorea,
A.m.scutellata, A.m.monticola, A.m.adansonii, A.m.unicolor,
A.m.capensis. Группа М включала подвиды из Северной Европы,
Пиренейского полуострова и Северной Африки: A.m.mellifera, A.m.iberica,
A.m.intermissa, A.m.sahariensis, A.m.major. В группу С входят подвиды
из Восточной Европы, Северного Средиземноморья, Центральной и Восточной
Европы, Балканского полуострова и Кавказа. Позже F. Ruttner (1988,
1992) разделил группу С на две С и О. В новую группу С стали входить
подвиды из Центральной и Восточной Европы и Балканского полуострова:
A.m.ligustica, A.m.carnica, A.m.macedonica, A.m.cecropia, A.m.sicula.
Группа О является основной группой подвидов с Кавказа, Средиземноморья
и Ближнего Востока: A.m.caucasica, A.m.armeniaca, A.m.meda,
A.m.anatoliaca, A.m.syriaca, A.m.cypria, A.m.adami.
Современные
исследования
показали низкий уровень аллозимного полиморфизма A.mellifera в Турции
(Kandemir с соавт., 2000) и заповеднике
“Шульган-Таш”
(Янбаев с соавт., 2000). По этой причине аллозимы не могут быть успешно
использованы в филогенетических исследованиях.
Первые успехи в
филогенетике, систематике и поиске маркеров были сделаны в RFLP мтДНК
(Smith, 1988; Smith с соавт., 1989,1991; Arias с соавт., 1990; Sheppard
с соавт., 1991; Garnery с соавт., 1993; Meixner с соавт., 1993), RAPD
анализе (Blanchetot, 1991, 1992; Hunt, Page, 1995), исследовании
микросателлитных повторов (Tares с соавт., 1993; Estoup с соавт.,
1995), секвенционном анализе мтДНК (Arias с соавт., 1996) и RFLP
ядерного генома (Hall, 1998).
Исследования
D.R.Smith
(1991) с использованием метода RFLP и J.M.Cornuet с соавт. (1991),
L.Garnery с соавт. (1992) методом секвенирования мтДНК показали
филогенетическую картину, где подтверждается наличие четырех подвидовых
групп Apis mellifera L., как и у F.Ruttner с соавт. (1978). Однако
группы М и О F. Ruttner с соавт. (1978) по составу значительно
отличаются. Работа M.Arias с соавт. (1996) с применением секвенса
митохондриальной ДНК подтверждает предыдущие результаты
молекулярно-генетичеких исследований.
A.Estoup с соавт.
(1995)
в своих исследованиях по семи микросателлитным локусам A113, B124, A7,
A24, A28, A88, A43 подтвердил существование и состав трех эволюционных
ветвей, первоначально выделенных F.Ruttner (1988), где каждая ветвь
представлена тремя различными образцами, принадлежащими семи различным
подвидам трех эволюционных ветвей F.Ruttner (1978) M, C, A. Ветвь M
представлена тремя популяциями из Avingon (Южная Франция, A.m.mellifera
L.), Valenciennes (Северная Франция, A.m.mellifera L.) и Umea (Швеция,
A.m.mellifera L.). Ветвь С представлена популяцией из Forli (Италия,
A.m.ligustica), Berlin (Германия, A.m.carnica), Chalkidiki (Греция,
A.m.cecropia). Ветвь А представлена популяциями из Johannesburg (Южная
Африка, A.m.scutellata), Cape Town (Южная Африка, A.m.capensis) и
Tinznit (Марокко, A.m.intermissa). Эти результаты были получены с
использованием различных дистанций – Cavalli-Sforza и
Edwards,
Das, Fst. Образцы A.m.intermissa из Морокко меняют свое положение в
зависимости от использования различных методов оценки генетических
дистанций. Так, при использовании стандартного генетического расстояния
M. Nei (1975) A.m.intermissa принадлежит ветви М, а при использовании
минимальной дистанции M. Nei (1975) – ветви А. Поэтому более
приемлем тот результат, где A.m.intermissa принадлежит ветви М,
соответственно результатам морфометрии F. Ruttner с соавт. (1978).
M.Arias c соавт.
(1996)
в своей работе также показали подразделение подвидов пчел на четыре
группы, где группа I содержит преимущественно африканские подвиды,
которые могут быть разделены на две подгруппы: северную I-N
(A.m.intermissa, A.m.sahariensis, A.m.sicula, A.m.iberica) и южную I-S
(A.m.capensis, A.m.adansonii, A.m.scutellata, A.m.monticola). Хотя
A.m.sicula, A.m.iberica не обитают на африканском континенте, они все
же кластеризуются в эту группу, благодаря их единому происхождению, что
подтверждает гипотезу F.Ruttner с соавт. (1978) о родстве пчел
Пиренейского полуострова и Северной Африки. Исследования A.Badino с
соавт. (1985), L.Garnery с соавт. (1993) также подтверждают такое
родство. Африканизированные пчелы из Бразилии кластеризуется с южной
африканской группой, так как они являются потомками A.m.scutellata.
A.m.adansonii и A.m.scutellata объединяются вместе, так как, по
предположению M.Arias c cоавт. (1996), между ними существует поток
генов в результате отсутствия географического барьера. Группа II
состоит из A.m.lamarckii и A.m.meda. M.Arias с соавт. (1996)
предполагают, что эта группа должна объединять подвиды Среднего Востока
и северо-восточной Африки. A.m.syriaca и A.m.yemenitica, возможно,
также будут входить в эту группу. Подвиды A.m.mellifera и A.m.ligustica
формируют группу III. Образцы A.m.ligustica из этой группы
характеризуются морфометрически как A.m.ligustica, а рестрикция мтДНК
EcoRI показывает гаплотип A.m.mellifera. A.Badino с соавт., (1984) и
A.Manino с соавт. (1984), используя аллозимный анализ, сообщают, что на
территории западной Италии происходит естественный вторичный контакт
между подвидами A.m.ligustica и A.m.mellifera. B.P.Oldroyd с соавт.
(1992), работая с популяцией пчел острова Кенгуру, показал, что пчелы,
морфометрически и по аллозимным данным классифицированные как
A.m.ligustica, показали гаплотип A.m.mellifera при использовании
рестрикции EcoRI мтДНК. Популяция пчел острова Кенгуру была образована
из пчел, которые были завезены из Австралии и Италии в прошлом веке
(Woodward, 1993, 1994, 1996). Видимо, пчелы были изначально
гибридизованы еще в Италии. M.D.Meixner с соавт. описали интрогрессию
популяций A.m.ligustica и A.m.carnica в северо-восточной Италии,
Словении и Австрии морфометрическими и митохондриальными маркерами.
J.M.Cornuet (1982), J.M.Cornuet с соавт. (1989), D.R.Smith с соавт.
(1991) морфометрическими, аллозимными и RFLP мтДНК данными показали,
что на территории Испании находится зона гибридизации между подвидами
A.m.mellifera и A.m.intermissa. Кроме того, нельзя игнорировать роль
человека в интродукции и селекции подвидов. Группу IV составляют
подвиды Средиземноморья: A.m.macedonica, A.m.ligustica, A.m.carnica и
A.m.meda. Два образца A.m.meda в работе M.Arias и W.Sheppard (1996)
располагаются в разных группах: один с африканскими подвидами, другой с
северо-средиземноморскими подвидами, что подтверждает гипотезу, что
ареал его текущего обитания (Сирия, Иран, Ирак и Турция) может быть
центром происхождения видов (Ruttner, 1988; Garnery с соавт., 1992;
Arias and Sheppard, 1996).
Африканской
группе
подвидов (группа I) соответствует предложенная Ruttner с соавт. (1978)
группа А; группе подвидов северного Средиземноморья (группа
IV)–
группа С; и A.m.mellifera (группа III) – группа М. В работе
M.Arias и W.Sheppard (1996) группа IV соответствует группе С, исключая
A.m.meda, которая по F. Ruttner (1988) принадлежит группе О.
М. Arias с соавт.
(1996)
подтверждают аналогию группы II с группой О F.Rutter (1988). Однако их
сходство только внешне, а по составу они различны. Группа О содержит
A.m.meda, но не содержит A.m.lamarckii. Гипотезу родства по
происхождению подвидов Среднего Востока и Африки подтверждает состав
группы II, которая объединяет A.m.lamarckii из Египта и A.m.meda из
Сирии. Исследование дополнительных подвидов из Турции, восточного
Средиземноморья и Кавказа, таких как A.m.anatoliaca и A.m.caucasica
позволит решить этот вопрос родства подвидов.
Type of Apis
mellifera
L. occupies a vast area that includes Africa, Europe and the Middle
East. Recently, as a result of human activities having hybrid
populations far removed from each other populations that do not
naturally occur together.
As a result,
morphometric studies F.Ruttner (1992) identified 25 subspecies Apis
mellifera L. (see. Fig.) A large number of subspecies due, apparently,
isolation and subsequent accumulation of genetic differences. In
Europe, this isolation could occur as a result of glaciation in the
Pleistocene period (Ruttner, 1992). In Africa, the insulation may have
occurred as a result of desertification, as well as the presence of
natural barriers in the form of mining and forest. So, Amsahariensis
was isolated by desertification and Ammonticola - mountain forest
(Arias, 1996). F.Ruttner et al. (1978) morphometric study showed the
separation of Apis mellifera L. subspecies into four groups: A, M, C
and O.
Group A included
the
African subspecies: Amlamarckii, Amyemenitica, Amlitorea, Amscutellata,
Ammonticola, Amadansonii, Amunicolor, Amcapensis. Group M subtypes
included from Northern Europe, the Iberian Peninsula and North Africa:
Ammellifera, Amiberica, Amintermissa, Amsahariensis, Ammajor. Group C
includes subspecies of Eastern Europe, Northern Mediterranean and
Central and Eastern Europe, the Balkans and the Caucasus. Later F.
Ruttner (1988, 1992), divided into two group C C and D. The new group
began to enter the sub-species of the Central and Eastern Europe and
the Balkans: Amligustica, Amcarnica, Ammacedonica, Amcecropia,
Amsicula. Group O is a core group of subspecies of the Caucasus, the
Mediterranean and the Middle East: Amcaucasica, Amarmeniaca, Ammeda,
Amanatoliaca, Amsyriaca, Amcypria, Amadami.
Recent studies
have
shown a low level of allozyme polymorphism A.mellifera Turkey (Kandemir
et al., 2000) and preserve "Shulgan-Tash" (Yanbaev et al., 2000). For
this reason, allozymes can not be successfully used in phylogenetic
studies.
The first
successes in
phylogenetics, taxonomy and search markers were made in RFLP of mtDNA
(Smith, 1988; Smith et al., 1989,1991; Arias et al., 1990; Sheppard et
al., 1991; Garnery et al., 1993; Meixner et al., 1993), RAPD analysis
(Blanchetot, 1991, 1992; Hunt, Page, 1995), study of microsatellite
repeats (Tares et al., 1993; Estoup et al., 1995), the analysis of
mtDNA sekventsionnom (Arias et al. , 1996), and RFLP nuclear genome
(Hall, 1998).
Studies DRSmith
(1991)
using the method of RFLP and JMCornuet et al. (1991), L.Garnery et al.
(1992) demonstrated by sequencing the mtDNA phylogenetic picture, which
confirms the presence of four groups of subspecies Apis mellifera L.,
like F.Ruttner et al. (1978). However, the group M and O F. Ruttner et
al. (1978) differ significantly in composition. Work M.Arias et al.
(1996) using mitochondrial DNA Sequence confirms previous results
genetichekih molecular studies.
A.Estoup et al.
(1995)
in their studies on seven microsatellite loci A113, B124, A7, A24, A28,
A88, A43 confirmed the existence and composition of the three branches
of evolution, originally allocated F.Ruttner (1988), where each branch
is represented by three different samples belonging to seven different
subspecies three evolutionary branches F.Ruttner (1978) M, C, A. M
branch is represented by three populations of Avingon (Southern France,
Ammellifera L.), Valenciennes (Northern France, Ammellifera L.) and
Umea (Sweden, Am mellifera L.). Branches with a population represented
from Forli (Italy, Amligustica), Berlin (Germany, Amcarnica),
Chalkidiki (Greece, Amcecropia). A branch is represented populations
from Johannesburg (South Africa, Amscutellata), Cape Town (South
Africa, Amcapensis) and Tinznit (Morocco, Amintermissa). These results
were obtained using different distances - Cavalli-Sforza and Edwards,
Das, Fst. Samples from Morocco Amintermissa change their position
depending on the use of different methods for assessing the genetic
distances. Thus, using the standard genetic distance M. Nei (1975)
Amintermissa belongs branches M, while using a minimum distance M. Nei
(1975) - A branch is therefore more acceptable the result where
Amintermissa belongs branches M, respectively, results morphometry F.
Ruttner et al. (1978).
M.Arias c et al.
(1996)
in his work also showed bee subspecies division into four groups, where
Group I comprises predominantly African subspecies, which can be
divided into two subgroups: the northern IN (Amintermissa,
Amsahariensis, Amsicula, Amiberica) and southern IS ( Amcapensis,
Amadansonii, Amscutellata, Ammonticola). Although Amsicula, Amiberica
not live on the African continent, they are still clustered in this
group because of their common origin, which confirms the hypothesis
F.Ruttner et al. (1978) about the relationship of the bees of the
Iberian Peninsula and North Africa. Research A.Badino et al. (1985),
L.Garnery et al. (1993) also confirm this relationship. Africanized
bees in Brazil clustered with the South African group, as they are
descendants Amscutellata. Amadansonii Amscutellata and come together,
as by assumption M.Arias c coavt. (1996), between them there is gene
flow as a result of the lack of geographical barriers. Group II
consists of Amlamarckii and Ammeda. M.Arias et al. (1996) suggest that
this group should unite subspecies of the Middle East and north-east
Africa. Amsyriaca and Amyemenitica, may also be included in this group.
Subspecies Ammellifera Amligustica and form a group III. Samples
Amligustica from this group are characterized by both morphometrically
Amligustica, and EcoRI restriction mtDNA haplotype shows Ammellifera.
A.Badino et al., (1984) and A.Manino et al. (1984) using allozyme
analysis, reported that in western Italy, there is a natural secondary
contact between the subspecies and Amligustica Ammellifera. B.P.Oldroyd
et al. (1992), working with the population of bees Kangaroo Island has
shown that bees, morphometric and allozyme data classified as
Amligustica, showed haplotype Ammellifera using EcoRI restriction
mtDNA. The population of bees Kangaroo Island was formed from the bees,
which were imported from Australia and Italy in the last century
(Woodward, 1993, 1994, 1996). Apparently, the bees were first
hybridized even in Italy. M.D.Meixner et al. described introgression
populations Amligustica and Amcarnica in northeastern Italy, Slovenia
and Austria morphometric and mitochondrial markers. J.M.Cornuet (1982),
J.M.Cornuet et al. (1989), D.R.Smith et al. (1991) morphometric,
allozyme and mtDNA RFLP data showed that in Spain there is a zone of
hybridization between subspecies and Ammellifera Amintermissa. In
addition, one can not ignore the role of humans in the introduction and
breeding subspecies. Group IV constitute the Mediterranean subspecies:
Ammacedonica, Amligustica, Amcarnica and Ammeda. Two samples Ammeda in
M.Arias and W.Sheppard (1996) are located in different groups: one with
African subspecies, the other from the north-Mediterranean subspecies,
which confirms the hypothesis that the area of its current habitat
(Syria, Iran, Iraq and Turkey ) may be the center of origin of species
(Ruttner, 1988; Garnery et al., 1992; Arias and Sheppard, 1996).
Subspecies of the
African Group (Group I) corresponds to the proposed Ruttner et al.
(1978) Group A; Northern Mediterranean subspecies group (Group IV) -
Group C; and Ammellifera (Group III) - Group M. In the M.Arias and
W.Sheppard (1996) Group IV Group C matches, excluding Ammeda, which by
F. Ruttner (1988) belongs to A.
M. Arias et al.
(1996)
confirm analogy Group II Group O F.Rutter (1988). However, the
similarity in appearance only, as they are different in composition.
Group D contains Ammeda, but does not contain Amlamarckii. The
hypothesis of relationship by descent subspecies of the Middle East and
Africa, confirmed the group II, which combines Amlamarckii Ammeda from
Egypt and Syria. Study additional subspecies from Turkey, the eastern
Mediterranean and the Caucasus, such as Amanatoliaca and Amcaucasica
will resolve the issue of kinship subspecies.
|
056.
Ильясов Р.А.,
Шареева З.В., Поскряков А.В., Кутлин Н.Г., Николенко А.Г. Пчелы
северных районов республики Башкортостан. Материалы II Международной
научно-практической конференции "Актуальные вопросы энтомологии".
Ставрополь. 2009. Выпуск 5. С. 12-16.
Для
определения распространения A.m.mellifera в северной части ареала
башкирской пчелы нами было проведено изучение популяций пчел с 42 пасек
трех северных районов республики Башкортостан (Бирский, Караидельский,
Мишкинский) с использованием морфометрических и
молекулярно-генетических методов. Мы показали, что популяция башкирской
пчелы подвида A.m.mellifera сохранилась в значительном количестве на
территории республики Башкортостан и имеет довольно широкое
географическое распространение. Северная часть ареала башкирской пчелы
имеет большую протяженность, чем предполагалось ранее.
For determination
of
distribution of A.m.mellifera in north part of natural areal of bashkir
bee we studied of bees populations from 42 apiaries from three northern
regions of the Bashkortostan republic (Birski, Karaidelski, Мyshkinski)
using morphometric and molecular-genetic methods. We showed that
population of bashkir bee of subspecies A.m.mellifera was saved in
generous amount in Bashkortostan republic and has wide geographical
distribution. North part of natural habitat of bashkir bee has a
greater extent, than was assumed before. |
055.
Ильясов
Р.А., Поскряков А.В. Стабильность генетических характеристик пчел
A.m.mellifera башкирской популяции на севере ареала. Материалы
международной конференции молодых ученых "Инновации молодых ученых -
основа устойчивого развития регионов". Уфа. 2009. С. 27-28.
В
статье приводятся выводы изучения полиморфизма локальных популяций
башкирской пчелы, обитающих на северной границе ареала с использованием
трех микросателлитных локусов ядерной ДНК. В данных популяциях мы
наблюдали незначительное отклонение распределения генотипов от
ожидаемого по Хади-Вайнбергу в сторону дефицита гетерозигот, что
обусловлено особенностями обитания пчел.
Уральская
популяция
темной европейской пчелы Apis mellifera mellifera уникальна своим
генофондом, который был сформирован длительным жестким естественным
отбором в горных лесах в условиях продолжительных зимних периодов с
критически низкими температурами. Башкирская пчела подвида
A.m.mellifera является уникально адаптированной к холодной
продолжительной зиме, к сопутствующим болезням, а также к бурному
кратковременному летнему взятку. Популяция башкирских пчел подвержена
значительному влиянию человека, в результате чего ее генофонд
изменяется. Условием продолжительного существования популяции пчел в
пределах своего ареала является стабильность популяционно-генетических
процессов и характеристик. Основной характеристикой популяции пчел
является уровень генетической гетерогенности, которая измеряется как
уровень биоразнообразия и гетерозиготности. Важной характеристикой
стабильности популяции пчел является неизменность генетических
характеристик во времени. Небольшое отклонение от ожидаемого значения
по Харди-Вайнбергу может также служить характеристикой относительного
постоянства генофонда, как и в случае отсутствия отклонений [1, c.
680].
Мы изучили пчел
из 91
семьи Бирского, 53 семей Мишкинского, 30 семей Татышлинского и 65 семей
Караидельского районов республики Башкортостан, охватывающие северную
часть ареала башкирской пчелы. Мы показали, что популяции пчел этих
районов в большинстве содержат семьи башкирских пчел подвида
A.m.mellifera, хотя изредка встречаются семьи гибридного происхождения.
Гибридные пчелы нежелательны в условиях Урала, так как они плохо
приспособлены к местным условиям и могут привести к убыткам и
дополнительным денежным расходам для поддержания их жизнедеятельности.
По результатам
анализа
полиморфизма микросателлитных локусов ар243, 4а110 и А8 ядерной ДНК в
этих популяциях пчел можно сказать, что отмечалась относительная
стабильность генетических характеристик, то есть не наблюдалось
значительных различий между наблюдаемым и ожидаемым значениями
гетерозиготности. Это показатель генотипического равновесии в изучаемых
популяциях пчел. Небольшой дефицит гетерозигот обусловлен, возможно,
особенностями их обитания и разведения, а различия генетических
характеристик среди локусов - особенностями распределения генотипов
каждого локуса.
The article
presents the
findings of the study of polymorphism of local populations Bashkir bees
living on the northern border of the area using three microsatellite
loci of nuclear DNA. In these populations, we observed a slight
deviation from the expected distribution of genotypes for Hadi-Weinberg
towards heterozygote deficiency, due to the peculiarities of bees
habitat.
Ural population
dark
European bee Apis mellifera mellifera is unique in its gene pool, which
was formed a long hard by natural selection in the mountain forests in
the conditions of long winters with critically low temperatures.
Bashkir bee subspecies Ammellifera is uniquely adapted to the cold and
long winter, to related diseases, as well as to rapid short-term summer
bribe. Bashkir bee population exposed to significant human impact,
resulting in her gene pool changes. The condition for the continued
existence of the bee population within its range is the stability of
population genetic processes and characteristics. The main
characteristic of the bee population is the level of genetic
heterogeneity, which is measured as a level of biodiversity and
heterozygosity. An important characteristic of the stability of the bee
population is the immutability of genetic characteristics in time. A
small deviation from the expected value for Hardy-Weinberg could also
serve as a characteristic of relative constancy of the gene pool, as
well as in the absence of abnormalities [1, c. 680].
We studied 91
families
of bees Birsk, Mishkinsky 53 families, 30 families and 65 families
Tatyshlinskogo Karaidelskogo areas of the Republic of Bashkortostan,
covering the northern part of the range of Bashkir bee. We've shown
that the bee population in most of these areas include family Bashkir
bee subspecies Ammellifera, although occasionally there are families of
hybrid origin. The hybrid bees are undesirable in terms of the Urals,
as they are ill-suited to local conditions and can lead to losses and
additional cash costs to maintain their livelihoods.
According to the
analysis of polymorphism of microsatellite loci ar243, 4a110 and A8
nuclear DNA in these populations of bees can say that relative
stability observed genetic characteristics, that is, there were no
significant differences between the observed and expected
heterozygosity values. It is a measure genotypic equilibrium in the
studied populations of bees. A small deficit of heterozygotes is due,
perhaps, the peculiarities of their habitat and breeding and genetic
characteristics differences among loci - especially the distribution of
genotypes of each locus.
|
054.
Шареева З.В.,
Ильясов Р.А., Поскряков А.В., Кутлин Н.Г., Николенко А.Г. Структура
популяциии северного ареала башкирской пчелы Apis mellifera mellifera
L. на основе фенотипических и генотипических исследований. Естественные
и технические науки. № 2 (40). 2009. С. 111-116.
Структура
популяциии
северного ареала башкирской пчелы Apis mellifera mellifera L. на основе
фенотипических и генотипических исследований (Structure of the
populations of
northern area of the Bashkir bee Apis mellifera mellifera L. on the
basis of
phenotypic and genotypic tests) Проблема
гибридизации темной лесной пчелы с южными
подвидами и сохранение генофонда среднерусских пчел А. т. mellifera
более
полувека является основной в развитии пчеловодства России. Для решения
этой
проблемы применяются как классические, так и современные
молекулярно-генетические
методы идентификации подвидовой принадлежности медоносных пчел.
Полученные нами
результаты сравнительных популяционно-генетических исследований
северного
ареала башкирской пчелы А.т.mellifera показали, что сочетание
относительно высоких
долей морфотипа М и частот PQ, PQQ, PQQQ может свидетельствовать о том,
что
процессы гибридизации не зашли еще далеко, и, при определенных усилиях,
возможно создание еще одного резервата Apis mellifera mellifera на
территории РБ.
Более детальный поиск островков генофонда Apis mellifera mellifera
целесообразен на наш взгляд и в других северных районах РБ. Таким
образом, из
проведенного исследования можно заключить, что островная популяция
башкирских
пчел подвида А. т. mellifera сохранилась на севере республики
Башкортостан и
имеет очень широкое распространение локальных популяций — от
юга (Бурзянский
район) до севера (Татышлинский район). Безусловно, популяция
неоднородна,
встречаются большие очаги гибридизации. Также необходимо отметить, что
для
проведения подобных исследований предпочтительно использовать различные
методы,
так как комплексный анализ данных дает более полное представление о
структуре
популяции. Problem hybridization dark forest bees with the
southern subspecies
and preservation of the gene pool Central Russian bees A. m. mellifera
over
half a century is a key in the development of beekeeping Russia. To
solve this
problem, apply both classic and modern molecular genetic methods for
identifying subspecies of honey bees. Our results of comparative
population
genetic Research northern area of the Bashkir bee A.t.mellifera showed
that the
combination of relatively high proportion of morphotype M and frequency
PQ,
PQQ, PQQQ may indicate that the processes of hybridization are not
logged in
yet far away, and, with some effort, it is possible the creation of
another
reserve Apis mellifera mellifera on the territory of Belarus. A more
detailed Search
islands gene pool Apis mellifera mellifera is appropriate in our
opinion and in
other northern areas of the Republic of Belarus. Thus, from this study
it can
be concluded that the island population Bashkir bee subspecies A. m.
mellifera
preserved in the north of the Republic of Bashkortostan and has a very
wide
distribution of local populations - from the south (Burzyansky
District) to the
north (Tatyshlinsky District). Of course, the population is
heterogeneous,
there are large pockets of hybridization. Also it should be noted that
for such
studies is preferable to use a variety of methods, as a comprehensive
analysis
of data provides a more complete picture of the structure of the
population. Publication
Name:
Shareeva ZV, Ilyasov R.A., Poskryakov A.V. Kutlin NG, Nikolenko A.G.
Structure
of the populations of northern area of the Bashkir bee Apis mellifera
mellifera
L. on the basis of phenotypic and genotypic tests. Natural and
technical
sciences. V. 2 (40). 2009, P. 111-116.
|
053.
Ильясов
Р.А., Поскряков А.В., Николенко А.Г. Происхождение и эволюция
медоносной пчелы Apis mellifera. Материалы докладов XXIII Любищевских
чтений "Современные проблемы эволюции". Ульяновск. 2009. С. 171-172.
Изучение
истории
возникновения рода Apis, к которому относится и медоносная пчела Apis
mellifera, представляет большой научный интерес. Первоначально, на
основе морфометрической классификации A.mellifera, было выделено 25
подвидов. В дальнейшем, на основе биохимической и генетической
классификации, было показано, что действительно существует
подразделенность на 25 подвидов, которые делятся на 5 эволюционных
ветвей. Существуют разногласия о ходе расселения пчел по всей
территории современного ареала.
Studying of
origin
history of genus Apis, which belong honey bee Apis mellifera was had
large scientific interest. Originally, on the basis of morphometric
classification of A.mellifera 25 subspecieses were selected. Furter, on
the basis of biochemical and genetic classification, it was shown
differentiation indeed to 25 subspecies which divide to 5 evolutional
branches. There are disagreements about motions of bees on all
territory on modern area.
|
052.
Ильясов
Р.А., Поскряков А.В., Николенко А.Г. Ареал распространения бурзянской
популяции башкирской пчелы. Материалы II международной научной
конференции "Актуальные проблемы экологической физиологии, биохимии и
генетики животных". Саранск. 2009. С. 61-63.
Задачей
нашего исследования является изучение популяций пчел южной части ареала
башкирской пчелы. Ранее проведенные нами исследования показали, что
башкирские пчелы по таксономии относятся к подвиду A.m.mellifera.
Первоначально единственным местом сохранения чистых линий этой пчелы
считался небольшой регион на юге Башкортостана, входящий в состав
заповедника «Шульган-Таш» Республики Башкортостан.
Дальнейшие исследования относились преимущественно к северной части
ареала башкирской пчелы и не было проведено каких-либо исследований в
обнаруженной первоначально популяции A.m.mellifera южной части ареала.
Ареал этой южной локальной популяции не определен в точности, а именно,
совпадает ли ареал с границами Бурзянского района или он гораздо шире.
Для исследования
были
отобраны пчелы из 5 выборок: с. Старосубхангулово (10 семей), с.
Новомусятово (10 семей), с. Иргизлы (10 семей) Бурзянского района, с.
Крутой Лог (5 семей) Абзелиловского района, с. Сюрень (4 семьи)
Кугарчинского района Республики Башкортостан (рис. 1). В исследовании
были использованы: локус COI-COII мтДНК, микросателлитные локусы ap243,
4a110, a8, a43 ядерной ДНК. Нами были рассчитаны частоты встречаемости
аллелей каждого локуса.
Частоты
встречаемости
комбинаций межгенного локуса COI-COII мтДНК были следующими: в
популяциях пчел всех выборок, кроме Сюрени, комбинация PQQ (маркер
A.m.mellifera) встречалась с частотой 1,0, тогда как в Сюрени
встречалась только комбинация Q (маркер A.m.caucasica) с частотой
1,0. Для получения информации о распределении популяций
необходимо рассчитать частоты аллелей и генетические расстояния.
Наиболее приемлемым расстоянием является генетическое расстояние M. Nei
(1978).
На основе данных
о
частотах распределения аллелей были рассчитаны генетические расстояния.
Наибольшие расстояния наблюдается между популяциями Сюрень и Крутой
Лог; Сюрень и Старосубхангулово. Наименьшие расстояния - между Крутой
Лог и Новомусятово; Старосубхагулово и
Новомусятово. Такая
группировка, в некоторой степени согласована как с географическим
расположением, так и генетическим составом этих популяций. В
дальнейшем, был проведен кластерный анализ с использованием метода
ближайшего соседа и построена дендрограмма (рис. 2). Так, популяция
Сюрень отделяется от всех, так как в ней представлены в основном
гибридные семьи пчел. Таким образом, картина кластерного анализа может
отражать до некоторой степени уровень миграции между популяциями, где
наиболее близкие популяции будут близки и генетически, тогда как
отдаленные популяции будут более изолированы друг от друга.
Таким образом,
проведенные исследования позволяют сделать вывод о том, что ареал
обитания бурзянской популяции башкирской пчелы A.m.mellifera, возможно
имеет расширение в восточном направлении в сторону Абзелиловского
района, тогда как на юге в Кугарчинском районе популяция была
подвержена значительной гибридизации.
The aim of our
research
is to study the bee populations of southern part of the range of
Bashkir bee. Earlier studies have shown us that the Bashkir bee
taxonomy are subspecies Ammellifera. Initially, the only place save the
clean lines of the bees was considered a small region in the south of
Bashkortostan, which is part of the reserve "Shulgan-Tash" of the
Republic of Bashkortostan. Further studies are concerned mainly to the
northern part of the range of Bashkir bee and was not carried out any
research in the detected initial population Ammellifera southern part
of the range. The area south of the local population is not defined
precisely, but it coincides with the boundaries of any area or district
Burzyansky it is much wider.
For the study
were
selected from bees 5 samples: p. Starosubhangulovo (10 families), p.
Novomusyatovo (10 families), p. Irgizly (10 families) region Burzyansky
with. Krutoy Log (5 families) region Abzelilovsky with. Suresnes (4
families) region of the Republic of Bashkortostan Kugarchinskogo (Fig.
1). The study used: locus COI-COII mtDNA microsatellite loci ap243,
4a110, a8, a43 nuclear DNA. We calculated the frequency of alleles for
each locus.
The frequency of
occurrence of combinations intergenic locus COI-COII mtDNA were as
follows: in populations of bees of all samples except Suresnes
combination PQQ (marker Ammellifera) occurs with a frequency of 1.0,
whereas in Suresnes met only the combination Q (marker Amcaucasica)
with frequency 10. For information on the distribution of populations
is necessary to calculate allele frequencies and genetic distances. The
most acceptable is genetic distance distance M. Nei (1978).
Based on the
distribution of allele frequencies were calculated genetic distance.
The greatest distance observed between populations of Suresnes and
Krutoy Log; Suresnes and Starosubhangulovo. The shortest distance -
between Krutoy Log and Novomusyatovo; Starosubhagulovo and
Novomusyatovo. This grouping, to some extent consistent with both the
geographical location and the genetic composition of populations.
Subsequently, a cluster analysis was performed using the nearest
neighbor method and a dendrogram constructed (Fig. 2). Thus, the
population is separated from all of Suresnes, since it contains mainly
hybrid bee colonies. Thus, the picture cluster analysis may reflect to
some degree the level of migration between populations where
populations are closest and genetically close, while more distant
populations are isolated from each other.
Thus, our studies
suggest that habitat Burzyan Bashkir bee populations Ammellifera,
perhaps has the extension eastwards towards Abzelilovsky area, while in
the south district Kugarchinskom population exposed to significant
hybridization. |
051.
Ильясов Р.А.,
Шареева З.В., Кутлин Н.Г., Поскряков А.В., Николенко А.Г. Изучение
границ ареала медоносной пчелы Apis mellifera mellifera на Южном Урале.
Аграрная Россия. Специальный выпуск. 2009. С. 37.
Изучение
границ ареала медоносной пчелы Apis mellifera mellifera на Южном Урале
(A study of the boundaries of the area of the honey bee Apis mellifera
mellifera in the South Urals) Пчелы с пасек Бирского района
характеризовались частотой встречаемости комбинации PQQ 0,94, тогда как
пчелы пасек двух других районов — 0,98. Такое значение
частоты
комбинации PQQ в популяции пчел Бирского района противоречит данным В.
Н. Саттарова (2000) и говорит о том, что пчелы среднерусской расы
представлены гораздо шире на Южном Урале. Полученные нами данные
позволяют говорить о сохранении среднерусских пчел в данных районах,
несмотря на завоз пчел других подвидов из южных регионов России
несколько десятков лет назад. Это позволяет предположить о
существовании вероятности восстановления аборигенного генофонда под
воздействием факторов окружающей среды, куда можно включить и
антропогенные факторы. Возможно, что ареал распространения пчел
среднерусской расы гораздо шире, чем мы предполагаем на данный момент.
Нами планируются дальнейшие исследования популяции пчел Южного Урала.
Bee apiaries with Birsk area characterized frequency of occurrence of
combinations PQQ 0,94, then bees apiaries two other areas - 0.98. such
a frequency combination of PQQ in bee populations The Siberian region
contradicted by VN Sattarova (2000) and suggests that the bees of
Central race presented a much wider in the southern Urals. Our data
suggest a maintaining the Central Russian bees in these areas, despite
on the importation of bees other subspecies from southern regions
Russia a few decades ago. this allows suggest the existence of a
probability restoration of native gene pool under the influence
environmental factors, which can be enable and anthropogenic factors.
Perhaps distribution area of the Central Russian bees race much wider
than we assume for the moment. We are planning to further study
population bees Southern Urals. Publication Name: Ilyasov R.A.,
Shareeva ZV, Kutlin NG, Poskryakov A.V. Nikolenko A.G. A study of the
boundaries of the area of the honey bee Apis mellifera mellifera in the
South Urals. Agrarian Russia. Special Issue. 2009, P. 37-38. |
050.
Шареева
З.В., Ильясов Р.А., Поскряков А.В.,
Кутлин Н.Г., Николенко А.Г. Пчеловодствo
северных районов Республики Башкортостан. Материалы международной
научно-практической конференции "Инновации в пчеловодстве. Технологии,
инвентарь, продукция". Сочи. 2009. С. 13-17.
Пчеловодство
является важной отраслью сельского хозяйства и служит источником для
опыления энтомофильных культур, получения ценных пище-вых и лечебных
продуктов и промышленного сырья. Пчеловодство – древнейшее
занятие многих народов, а потому интерес к изучению этих насекомых со
временем только возрастает. Одной из основных проблем последних
десятилетий, решаемых на международном уровне, является межрасовая
гибридизация. В России существует проблема гибридизации местных пчел с
южными подвидами и сохранения генофонда среднерусских пчел Apis
mellifera mellifera L. Данные вопросы рассматриваются не только
отечественными (Линаск Э. А., 1989; Черевко Ю. А., 1995, 2005; Кривцов
Н. И., 1995, 1996, 2005; Бородачев А.В., Савушкина Л.Н., 2007 и многие
другие) и зарубежными исследователями (Franck et al., 1998; Arias,
Sheppard, 1996; 2005; Jensen et al., 2005), но и решаются на уровне
государств и республик (Закон Республики Башкортостан о пчеловодстве,
1995; указ Президента Республики Башкортостан №УП-685 «О
развитии
пчеловодства в Республике Башкортостан», 2003; Постановление
прави-тельства Республики Башкортостан №223 о республиканской целевой
про-грамме «Развитие пчеловодства в Республике
Башкортостан», 2005).
По словам Черевко
Ю. А.
(2005), за последние 60-70 лет во многих регионах России и других
странах произошла и происходит бессистемная метизация пчел, приведшая к
необратимым процессам, препятствующим восстановлению первоначального
исходного местного чистопородного материала. Начиная с тридцатых годов
прошлого столетия южных пчел в большом количестве завозили в
центральную зону России. Автор отмечает, что особый размах метизация
пчел получила благодаря часто научно необоснованной пропаганде
использования помесей для получения эффекта гетерозиса и
бесконтрольному протеканию данного процесса. В результате сильно
пострадала среднерусская пчела, которая практически исчезла в некоторых
местах ее традиционного разведения.
Анализируя
состояние
генофонда среднерусских пчел, Кривцов Н.И. (2005) считает, что
основания для тревоги есть, но положение не столь драматично. В
Западной Европе вытеснение темной лесной пчелы началось еще раньше
(около 150 лет назад) и шло интенсивнее, чем в России, тем не менее, в
некоторых странах Западной Европы еще сохранились популяции темной
европейской пчелы Apis mellifera mellifera. Для улучшения сложившейся
ситуации, по мнению Кривцова Н.И., необходимо поставить вопрос о
создании совета по пчеле среднерусской расы в рамках
селекционно-информационного центра при НИИ пчеловодства.
Вопрос о
сохранении
аборигенной пчелы в первую очередь связан с ее преимуществами перед
гибридными. Среднерусские пчелы обладают более высокой зимостойкостью,
меньше реагируют на резкие колебания температуры. Весеннее развитие
пчелиных семей начинается немного позже, а затем ее интенсивность
быстро нарастает. По медопродуктивно-сти среднерусские пчелы в условиях
бурного медосбора с липы, гречихи, вереска и других медоносов
превосходят гибридных, испытываемых в этих условиях. Они обладают
хорошей воскопродуктивностью и способностью приносить много пыльцы.
По данным
Р.А.Ильясова с
соавт. (2006) на Урале сохранились резерваты Apis mellifera mellifera
L. в Бурзянском и Татышлинском районах Республики Башкортостан и
Пермском крае. Мы решили продолжить поиск сохранившихся локальных
популяций и задались целью исследовать для начала три северных района
Республики Башкортостан: Бирский, Мишкинский и Караидельский. Интересен
тот факт, что по результатам Саттарова В.Н. (2000) в Бирском районе в
СПК «Ленина» более 50% пчел являлись гибридными.
Бирский,
Мишкинский и
Караидельский районы относятся к лесостеп-ной зоне северной подзоне
Республики Башкортостан. Данная местность имеет облесенность от 25 до
70%, массивы которой представлены елово-пихтово-сосновым древостоем с
примесью широколиственных: липы, березы, осины. Период медосбора
недолгий, главный - приходится на июль. Безоблетное время длится до
шести месяцев. Многие пчеловоды предпочитают зимовку на улице. В
подобных условиях гибридным пчелам выжить нелегко (Власов, 1983).
По словам
начальника
Бирского межрайонного объединения (МРО) пчеловодства Н.М.Фаттахова
(2008) пчеловодство в наших районах насчи-тывает многолетнюю историю.
Люди занимались пчеловодством еще до ре-волюции, в том числе и во всех
существующих монастырях. В период коллективизации многие пасеки были
объединены в крупные колхозные. Для их обслуживания в северной зоне в
1948 году было организовано Бирское МРО пчеловодства. Позже были
организованы Мишкинское и Караидельское МРО. Общее руководство
пчеловодством осуществляла Башпчелоконтора при МСХ БАССР. Всего по
Башкирии было 4 МРО: Уфимское, Стерлитамакское, Бирское и Туймазинское.
Каждое из них обслуживало 14 районов.
В 1960-1970гг.
был
массовый завоз серых горных кавказских пчел в северные районы
Республики Башкортостан для опытных целей, что позднее было запрещено.
В эти годы пчеловодству уделялось большое внимание со стороны
правительства. Было организовано производство ульев, построен
воскоперерабатывающий завод. Каждую зиму с пчеловодами хозяйств
проводилась учеба по повышению квалификации, для чего была создана
школа пчеловодства, работала Башкирская опытная станция пчеловодства.
По данным Власова
В.Н.
(1983) в 1970-80гг. была налажена хорошая работа на матковыводных
пасеках (1,5-2 тыс. маток) Мишкинского района. На пасеках
Караидельского района проводилось испытание и использование дочерей от
рекордисток и это показало, что такая селекция способствует улучшению
полезных признаков местных пчел и обеспечивает устойчивую
медопродуктивность рядовых пасек в последующие годы. От уровня
племен-ной работы зависели качество семей и товарность пасек,
увеличение производства высококачественного башкирского целебного меда.
Во времена
перестройки
многие колхозные пасеки были распроданы, зоотехнические службы
–
расформированы. Появились новые заготовители. МРО утратило свои позиции
за отсутствием оборотных средств. С конца 2006 года каждый район
работает самостоятельно. По мнению Фаттахова Н. М., настоящее время
– время частного пчеловодства, что снижает возмож-ность
контроля
свыше, но не мешает анализировать их состояние.
Для исследований
были
отобраны пчелы с 42 пасек трех районов, не менее чем из 25% пчелосемей
с пасеки. С каждой семьи брали по 5 рабочих особей, которых фиксировали
в 96% этаноле и хранили в морозильной камере. ДНК выделяли из
летательных мышц пчел по методу смесью
гуанидинтиоционат-фенол-хлороформ (Chomezynski, Sacchi, 1987).
В анализе
популяций в
качестве генетического маркера использовали межгенный локус COI-COII
мтДНК, полиморфизм которого был установлен ранее у представителей
разных подвидов Apis mellifera (Cornuet et al., 1991). А.Г.Николенко и
А.В.Поскряков (1998) ранее использовали этот полиморфизм в качестве
маркера для различения подвидов A.m.mellifera и A.m.caucasica (Ильясов
Р.А., 2006). Этот маркер был использован нами для поиска популяций
A.m.mellifera.
Полимеразную
цепную
реакцию (ПЦР) проводили в термоциклере «Циклотерм»
при
оптимальном для каждого локуса температурном режиме. Выделенную ДНК
проверяли на качество в агарозном геле и а продукты ПЦР
электрофоретически фракционировали в полиакриламидном геле, после чего
окрашивали бромистым этидием и фотографировали в трансиллюминаторе.
По исследуемым
нами
районам (Бирский, Мишкинский, Караидель-ский) анализ полиморфного
межгенного локуса COI-COII мтДНК показал, что частота комбинации PQQ,
характеризующего пчелу среднерусской расы, более 90%. Полученные нами
данные позволяют говорить о сохранении среднерусских пчел в данных
районах, куда ранее были завезены пчелы других подвидов из южных
регионов России. Это позволяет предположить возможность восстановления
аборигенного генофонда под воздействием факторов окружающей среды, куда
можно включить и антропогенные факторы.
В настоящее время
нами
проводятся сравнительные популяционно-генетические исследования
выделенных популяций с изучением полимор-физма микросателлитных локусов
ядерного генома, так как митохондриаль-ная ДНК позволяет судить лишь о
материнской наследственности.
Beekeeping is an
important sector of agriculture and serves as a source for pollination
of entomophilous crops, production of valuable food-O and medical
products and industrial raw materials. Beekeeping - the oldest
occupation of many nations, and because the interest in the study of
these insects over time will only increase. One of the main problems of
the last decades to be solved at the international level is the
interracial hybridization. In Russia, there is a problem with the
hybridization of native bees southern subspecies and genetic
conservation Central Russian bee Apis mellifera mellifera L. These
issues are addressed not only to domestic (Linask EA, 1989; Cherevko
YA, 1995, 2005; NI Krivtsov 1995, 1996, 2005; Borodachev AV Savushkin
LN, 2007 and many others) and foreign researchers (Franck et al., 1998;
Arias, Sheppard, 1996; 2005; Jensen et al., 2005) but also solved at
the level of states and republics (Law of the Republic of Bashkortostan
on beekeeping, 1995 decree of the President of the Republic of
Bashkortostan UP-685 "On the development of beekeeping in the Republic
of Bashkortostan", 2003; Resolution of the Government was the Republic
of Bashkortostan №223 of the republican target pro- Programme
"Development of beekeeping in the Republic of Bashkortostan", 2005).
According
Cherevko Yu
(2005), for the last 60-70 years in many regions of Russia and other
countries has occurred and there is unsystematic cross-breeding of
bees, which led to an irreversible process, hindering recovery of the
original source of local thoroughbred material. Since the thirties of
the last century southern bees in large quantities were imported into
the central zone of Russia. The author notes that the scope of a
special cross-breeding of bees got through the often unscientific
promoting the use of hybrids to produce the effect of heterosis and
uncontrolled leakage of the process. As a result, I suffered greatly
Central Russian bee, which has virtually disappeared in some areas of
its traditional breeding.
Analyzing the
gene pool
of the Central Russian bees NI Krivtsov (2005) believes that there is
cause for concern, but the situation is not so dramatic. In Western
Europe, the displacement of the dark forest bees started even earlier
(about 150 years ago) and went harder than in Russia, however, in some
countries of Western Europe are still preserved populations dark
European bee Apis mellifera mellifera. To improve the situation,
according to NI Krivtsov, you must raise the question of the
establishment of the Board of the Central Russian bee races in the
framework of breeding and information center at the Institute of
beekeeping.
The issue of
preservation of native bees in the first place associated with its
advantages over hybrid. Central Russian bees have higher winter
hardiness, less responsive to rapid changes in temperature. The spring
development of bee colonies begins a little later, and then its
intensity rapidly increases. By Medoproduktivnost-sti Central Russian
bees in terms of rapid medosbora with lime, buckwheat, heather honey
plants and other superior hybrid tested in these conditions. They have
a good voskoproduktivnostyu and the ability to bring a lot of pollen.
According
R.A.Ilyasova
et al. (2006) Urals preserved reserves Apis mellifera mellifera L. in
Burzyan and Tatyshlinskom areas of the Republic of Bashkortostan and
the Perm region. We decided to continue the search for the remaining
local populations and set out to explore to begin the three northern
region of the Republic of Bashkortostan: Birsky, Mishkinskoye and
Karaidelsky. An interesting fact is that the results Sattarova VN
(2000) Birsk area in the SEC "Lenin" over 50% of the bees is a hybrid.
Birsky,
Mishkinskoye and
Karaidelsky areas are forest-steppe zone of the North-term sub-zone of
the Republic of Bashkortostan. The area has a forest cover of 25 to
70%, which shows arrays spruce-fir-pine stands with an admixture of
deciduous: linden, birch, aspen. Medosbora short period, the main - is
in July. Bezobletnoe time lasts up to six months. Many beekeepers
prefer to winter in the street. In such circumstances the hybrid bees
to survive is not easy (Vlasov, 1983).
According to the
head of
interdistrict Birsk Association (MPO) Beekeeping N.M.Fattahova (2008)
Beekeeping in our neighborhoods naschi Pipeline long history. People
engaged in beekeeping before re-revolution, including all existing
monasteries. During the period of collectivization, many apiaries were
merged into large collective farms. For their service in the northern
zone in 1948 it was organized by the MPO Birsk beekeeping. Later they
were organized and Mishkinskoye Karaidelskoe MPO. The general
management of beekeeping in the Ministry of Agriculture carried out
Bashpchelokontora BASSR. Total Bashkiria was 4 MPO: Ufa, Sterlitamak,
and Birsk Tuymazinskoe. Each of them served 14 districts.
In 1960-1970gg.
It was a
massive importation of gray mountain Caucasian bees in the northern
areas of the Republic of Bashkortostan for power purposes, which was
later banned. During these years, beekeeping has received considerable
attention from the government. It organized the production of beehives
built voskopererabatyvayuschy plant. Every winter, beekeepers
households conducted studies on professional development, which has
created a school of beekeeping, worked Bashkir beekeeping Experiment
Station.
According to
Vlasov, VN
(1983) in 1970-80gg. was arranged a good job on matkovyvodnyh apiaries
(1,5-2 thousand. queens) Mishkinsky area. On apiaries Karaidelskogo
District conducted testing and use of the daughters of rekordistok and
it showed that this helps to improve the selection of useful traits of
local bees and provides a stable medoproduktivnost ordinary apiary in
the following years. From the level of tribes-term quality of the work
depended families and marketability of apiaries, increasing the
production of high-quality curative Bashkir honey.
During
perestroika, many
kolkhoz apiary were sold, livestock Service - disbanded. There are new
collectors. MPO has lost its position in the absence of working
capital. Since late 2006, each district operates independently.
According Fattakhova NM, is now - time private beekeeping, which
reduces the possibility of control over, but does not prevent analyze
their condition.
For the study
were
selected from 42 apiaries bee three areas of at least 25% of bee
colonies from the apiary. Each family took 5 working specimens which
were fixed in 96% ethanol and stored in a freezer. DNA was isolated
from muscle flying bee method guanidintiotsionat mixture
phenol-chloroform (Chomezynski, Sacchi, 1987).
In the analysis
of the
population as a genetic marker used intergenic locus COI-COII mtDNA
polymorphisms which was previously set at representatives of different
subspecies of Apis mellifera (Cornuet et al., 1991). A.G.Nikolenko and
A.V.Poskryakov (1998) have previously used this polymorphism as a
marker to distinguish between subspecies and Ammellifera Amcaucasica
(Ilyasov RA 2006). This marker was used to search for our populations
Ammellifera.
Polymerase chain
reaction (PCR) was performed in a thermal cycler "Tsikloterm" at the
optimum temperature for each locus mode. The isolated DNA was checked
on quality agarose gel and PCR products were fractionated
electrophoretically in a polyacrylamide gel, then stained with ethidium
bromide and photographed in transilluminator.
In the studied
areas
(Birsky, Mishkinskoye, Karaidel-sky) an analysis of polymorphic
intergenic locus COI-COII mtDNA showed that the frequency combination
of PQQ, which characterizes Central Russian bee race, more than 90%.
Our data suggest the Central Russian bees in maintaining these areas,
where the bees were brought before other subspecies of the southern
regions of Russia. This suggests the possibility of restoring the
indigenous gene pool under the influence of environmental factors,
which can be switched on and anthropogenic factors.
Currently, we
carry out
a comparative population genetic studies dedicated to the study of
population polymorphism-phism microsatellite loci of the nuclear
genome, as mitochondrial DNA Nye gives an indication only of maternal
inheritance. |
049.
Ильясов
Р.А., Шареева З.В., Поскряков А.В.,
Кутлин Н.Г., Николенко А.Г. Изучение генетической вариабельности в
популяции пчел Урала и Поволжья. Материалы международной
научно-практической конференции "Инновации в пчеловодстве. Технологии,
инвентарь, продукция". Сочи. 2009. С. 136-140.
Одним
из основных условий успешного пчеловодства является знание о
генетической структуре и уровне вариабельности популяции пчел.
Условиями стабильности популяции являются равновесие Харди-Вайнберга,
отсутствие потока генов между популяциям и оптимальный уровень
генетической вариабельности. Стабильность популяции пчел постоянно
нарушается под воздействием антропогенных факторов. Данные о структуре
генофонда могут дать популяционные исследования.
Первоначально
в популяционных исследованиях использовался только анализ
морфометрических признаков. Его основу заложил Г.А.Кожевников (1900),
который сделал промеры длины хоботка пчел и предложил методику
измерения их хитиновых частей. Современная морфометрическая
классификация A.mellifera основывается на работах G.Goetze (1940),
В.В.Алпатова (1948) и F.Ruttner et al. (1978). Также стандарты
морфометрии были получены в нашей лаборатории для подвида A.m.mellifera
башкирской популяции (Саттаров, Николенко, 2002). Однако выяснилось,
что морфометрические методы часто не позволяли точно идентифицировать
подвиды из-за сильной зависимости морфометрических характеристик пчел
от условий окружающей среды и уровня внутривидовой гибридизации
(Guzman-Novoa et al., 1994; Симанков, 1999; Roubik et al., 2001).
Впоследствии
большинство исследователей пчел стало переходить на использование
молекулярных маркеров (Arias, Sheppard, 1996), дающих более точные,
однозначно интерпретируемые результаты по сравнению с морфометрическими
методами. Изучение различий в частотах аллелей энзимов, которое вызвано
генетическими изменениями, в конце 60-х годов легло в основу метода
изучения популяций пчел с использованием аллозимного полиморфизма
(Richardson et al., 1986, Behura, 2006). Для гаплодиплоидных
Heminoptera сначала предсказывали высокий уровень полиморфизма
аллозимов (Mestriner, 1969; Crozier, 1973; Tomaszewski et al., 1973;
Contel et al., 1977). Однако у медоносной пчелы A.mellifera был отмечен
очень низкий уровень аллозимного полиморфизма, где из 23 ферментов
полиморфными оказались только 2 (Sheppard, Berlocher, 1984) и из 30 -
только 1 у пчел европейских популяций (Nunamaker, 1980), а у пчел
башкирской популяции A.m.mellifera из 25 - только 3 (Косарева с соавт.,
2000). Низкий уровень аллозимного полиморфизма был показан также для
других представителей Hymenoptera (Metcalf et al., 1975; Lester,;
Snyder, 1975; Pamilo et al., 1975; Selander, 1979). По причине низкой
вариабельности аллозимов они не могли быть использованы в дальнейших
популяционных исследованиях пчел A.mellifera, а также для различения
подвидов (Mestriner, 1969; Badino et al., 1982; Cornuet, 1983;
Sheppard, McPheron, 1986; Sheppard, Berlocher, 1984; Sheppard, 1988;
Del Lama et al., 1988, 1990; Lobo et al., 1989; Meixner et al., 1994).
Первоначальные
исследования генофонда пчел с использованием метода RFLP (полиморфизма
длин рестрикционных фрагментов) проводились на тотальной
митохондриальной ДНК (мтДНК). D.R.Smith, W.M.Brown (1988) показали
генетические различия подвида A.m.mellifera от африканизированных пчел
в США методом RFLP мтДНК эндонуклеазами BcII, EcoRI, NdeI, XbaI.
Открытие
PCR (полимеразной цепной реакции) в 80-х годах (Mullis et al., 1994)
сделало возможным изучение полиморфизма ДНК и привело к революции в
области молекулярной биологии. В результате для изучения полиморфизма в
популяциях пчел стали использовать модифицированный вариант RFLP, где
происходит рестрикция амплифицированных фрагментов ДНК. H.G.Hall,
D.R.Smith (1991) на основе RFLP анализа амплифицированных фрагментов
генов CO-I и CO-II эндонуклеазами EcoRI, HincII, Xba I показали уровень
генетической вариабельности популяции пчел Испании. На основе RFLP
анализа амплифицированногго фрагмента межгенного локуса COI-COII мтДНК
с использованием эндонуклеазы DraI была изучена генетическая структура
популяции пчел Франции (Franck et al., 1998), Италии (Franck et al.,
2000), Норвегии, Швеции, Дании, Шотландии, Англии, Ирландии (Jensen et
al., 2005).
Параллельно
с методом модифицированной RFLP в изучении генома пчел развивался метод
RAPD (полиморфизм длин амплифицированных фрагментов со случайно
выбранными праймерами). Метод RAPD нашел применение в исследованиях
генома медоносной пчелы (Чудинов, 1999). С использованием метода RAPD
G.J.Hunt и R.E.Page (1995) составили 26 групп сцепления и картировали
гены определения пола, цвета тела и малат дегидрогеназы пчел.
Помимо
метода RAPD в популяционных исследованиях пчел использовалась
аллель-специфичная PCR. В нашем институте был разработан метод
идентификации подвида A.m.mellifera на Урале в Республике Башкортостан
на основе электрофоретического разделения в агарозном геле
амплифицированных локусов межгенного локуса COI-COII мтДНК. Наша
лаборатория также проводила поиск популяций подвида
A.m.mellifera на
Южном и Среднем Урале на территории республики Башкортостан и Пермского
края с ипользованием полиморфизма межгенного локуса COI-COII мтДНК
(Сатаров, Николенко, 2000; Николенко, Поскряков, 2002) в результате
чего были выделены сохранившиеся популяции A.m.mellifera
(Ильясов,
2005; Ильясов с соавт., 2006, 2007, 2008).
Методика
изучения генетического полиморфизма популяций пчел на основе
полиморфизма SSR (микросателлитных локусов) основана также на
аллель-специфичной PCR. В последнее время полиморфизм микросателлитных
локусов широко используется во всем мире в изучении генетической
структуры и уровня вариабельности популяций пчел разными
исследователями. Так A.Estoup et al. (1995) изучал эти вопросы на
основе полиморфизма 7 микросателлитных локусов (B124, A7, A24, A113,
A28, A88, A43), а P.Franck et al. (1998, 2000) на основе оценки
полиморфизма 8 микросателлитных локусов в разных странах Европы, P.De
La Rua et al. (2002) - на основе оценки полиморфизма 8 микросателлитных
локусов в Северо-Восточной Италии, A.Jensen et al. (2005) - 11
микросателлитных локусов в Норвегии, Швеции, Дании, Шотландии, Англии,
Ирландии. В нашей лаборатории Р.А.Ильясов (2006) и Ильясов с соавт.,
2006, 2007, 2008 на основе полиморфизма 2 микросателлитных локусов
(Ap243, 4a110) изучили генетическую вариабельность популяций пчел на
Южном и Среднем Урале на территории Республики Башкортостан и Пермского
края.
Секвенирование
ДНК также является часто используемым методом в
популяционно-генетических исследованиях пчел. J.-M.Cornuet et al.
(1991) просеквенировали межгенный локус COI-COII мтДНК пчел и показали
различия A.m.mellifera от других подвидов. После изобретения
автоматического секвенатора стало доступным секвенирование большого
количества образцов за сравнительно короткое время. M.C.Arias,
W.S.Sheppard (1996) на основе секвенирования фрагмента гена ND2 мтДНК
показали различия A.m.mellifera от других подвидов пчел в Европе. В
нашей лаборатории Р.А.Ильясов с соавт. (2006) на основе секвенирования
фрагмента гена ND2 мтДНК показали различия A.m.mellifera от южных
подвидов пчел на Урале на территории республики Башкортостан. Совсем
недавно сотрудники консорциума по секвенированию генома пчелы
просеквенировали весь геном медоносной пчелы и показали различия между
A.m.mellifera и другими подвидами (Weinstock et al., 2006). Было
показано, что подвид A.m.iberica очень сходен с A.m.mellifera и при
кластерном анализе группируются вместе.
Самым
новым и многообещающим методом генетической анализа пчел является
изучение полиморфизма SNP (однонуклеотидного полиморфизма), на основе
чего можно будет составить генетический паспорт пчелы, очень быстро и
дешево определить подвидовую принадлежность пчел и филогенетический
паттерн. На сегодняшний день для медоносной пчелы известно несколько
тысяч SNP (Whitfield et al., 2006).
Изучение
генетической вариабельности в популяции пчел Урала и Поволжья было
выполнено с использованием порядка 10 генетических маркеров. Оказалось,
что пчелы не по всем маркерам обладают значительным полиморфизмом. Так
микросателлитный локус ap049 в популяции пчел Башкортостана обладал
очень незначительным полиморфизмом и в дальнейшем не был использован.
Также отсутствовал полиморфизм длины у генов ND2 мтДНК, COI мтДНК и
интрона гена EF1-α ядерной ДНК – у них наблюдается
SNP полиморфизм,
который выявляется только секвенированием. Полиморфизм этих генов также
частично выявляется рестрикцией эндонуклеазой DraI. Значительным
полиморфизмом обладали все остальные микросателлитные локусы
– ap243,
4a110, A8, A113 ядерной ДНК. Очень интересный полиморфизм наблюдался у
межгенного локуса COI-COII мтДНК, где мы обнаружили существование 4
гаплотипов (Q, PQ, PQQ и PQQQ). Кроме того, в популяции пчел Урала и
Поволжья полиморфным является ген антибактериального пептида дефензина
(Львов, 2002). Оказалось, что для большинства популяций пчел, где не
происходит массовый ввоз семей, наблюдается некоторая доля инбридинга,
тогда как в популяциях, в которые завозят пчел извне, наблюдается
аутбридинг. По результатам исследований было опубликовано ряд работ в
журналах «Пчеловодство» и
«Генетика».
Лаборатория
биохимии адаптивности насекомых Института биохимии и генетики Уфимского
НЦ РАН заинтересована в расширении ареала исследований и числа
анализируемых локусов пчел, а также в сотрудничестве с крупными и
частными пчеловодными хозяйствами. По результатам тестов мы можем
предоставить данные о генетической структуре, подвидовом составе,
направлении генетических процессов и ходе эволюционных преобразований
исследуемых пасек.
One
of the main conditions for successful beekeeping is the knowledge of
the genetic structure and the level of variability in the population of
bees. Stability conditions of the population is in Hardy-Weinberg
equilibrium, lack of gene flow between populations and the optimum
level of genetic variability. The stability of the bee population is
constantly violated under the influence of anthropogenic factors. Data
on the structure of the gene pool can provide population-based studies.
Initially,
population studies used only the analysis of morphometric characters.
He laid the foundation G.A.Kozhevnikov (1900), who made measurements of
the proboscis bees and proposed a method of measuring their chitin
parts. Modern morphometric classification is based on the works of
A.mellifera G.Goetze (1940), V.V.Alpatova (1948) and F.Ruttner et al.
(1978). Also standard morphometry were obtained in our laboratory for
the subspecies Ammellifera Bashkir population (Sattar, Nikolenko,
2002). However, it became clear that the morphometric methods often do
not accurately identify the subspecies of the strong dependence of
morphometric characteristics of bees on the environment and the level
of intraspecific hybridization (Guzman-Novoa et al., 1994; Simankov,
1999; Roubik et al., 2001).
Subsequently,
most of the researchers was the bees to pass on the use of molecular
markers (Arias, Sheppard, 1996), giving a more precise, uniquely
interpretable results compared with morphometric methods. The study of
differences in the frequencies of alleles of enzymes, which is caused
by genetic changes, at the end of the 60s was the basis of the method
of studying bee populations using allozyme polymorphism (Richardson et
al., 1986, Behura, 2006). For haplodiploid Heminoptera first predicted
high level of polymorphism allozymes (Mestriner, 1969; Crozier, 1973;
Tomaszewski et al., 1973; Contel et al., 1977). However, the honey bee
A.mellifera was marked very low allozyme polymorphism, where 23
polymorphic enzymes appeared only 2 (Sheppard, Berlocher, 1984) and 30
- only 1 in bees European populations (Nunamaker, 1980), and the bees
of the Bashkir Ammellifera population of 25 - only three (Kosarev et
al., 2000). Low Allozyme polymorphism has been shown for other members
of the Hymenoptera (Metcalf et al., 1975; Lester ,; Snyder, 1975;
Pamilo et al., 1975; Selander, 1979). Due to the low variability
allozymes they could not be used in further population studies bees
A.mellifera, as well as to distinguish between subspecies (Mestriner,
1969; Badino et al., 1982; Cornuet, 1983; Sheppard, McPheron, 1986;
Sheppard, Berlocher, 1984; Sheppard, 1988; Del Lama et al., 1988, 1990;
Lobo et al., 1989; Meixner et al., 1994).
Initial
studies of the gene pool of bees using the method of RFLP (restriction
fragment length polymorphism) were carried out on a total of
mitochondrial DNA (mtDNA). DRSmith, WMBrown (1988) have shown genetic
differences Ammellifera subspecies of Africanized honey bees in the
United States by mtDNA RFLP endonucleases BcII, EcoRI, NdeI, XbaI.
Opening
of PCR (polymerase chain reaction) in 80 years (Mullis et al., 1994)
has made it possible to study DNA polymorphism and led to a revolution
in the field of molecular biology. As a result of studying polymorphism
in bee populations started using a modified version of RFLP, where the
restriction of the amplified DNA fragments. HGHall, DRSmith (1991)
based on RFLP analysis of the amplified gene fragments CO-I and CO-II
endonuclease EcoRI, HincII, Xba I showed a level of genetic variability
bee population Spain. On the basis of RFLP fragment analysis
amplifitsirovannoggo intergenic locus COI-COII mtDNA with endonuclease
DraI was studied genetic structure of the population of bees in France
(Franck et al., 1998), Italy (Franck et al., 2000), Norway, Sweden,
Denmark, Scotland, England, Ireland (Jensen et al., 2005).
In
parallel with the modified RFLP method in studying the genome of bees
developed technique RAPD (amplified fragment length polymorphism with
randomly selected primers). RAPD method has been applied in the study
of the genome of the honey bee (Chudinov, 1999). Using the method of
RAPD GJHunt and REPage (1995) amounted to 26 linkage groups and mapped
the genes of sex determination, the color of the body and malate
dehydrogenase bees.
In
addition to the RAPD method in population studies of bees used
allele-specific PCR. Our institute has been developed a method of
identifying subspecies Ammellifera the Urals in the Republic of
Bashkortostan on the basis of electrophoretic separation in an agarose
gel of amplified loci intergenic locus COI-COII mtDNA. Our laboratory
also conducted search Ammellifera subspecies populations in the South
and Middle Urals, on the territory of the Republic of Bashkortostan and
the Perm edge programs included with polymorphism intergenic locus
COI-COII mtDNA (Satarov, Nikolenko, 2000; Nikolenko, Poskryakov, 2002)
resulting in the marked surviving populations Ammellifera (Ilyasov,
2005; Ilyasov et al., 2006, 2007, 2008).
Method
for studying the genetic polymorphism of bee populations on the basis
of polymorphism SSR (microsatellite loci) is also based on
allele-specific PCR. Recently, a polymorphism of microsatellite loci
are widely used around the world in the study of the genetic structure
and the level of variability of bee populations by different
researchers. Thus A.Estoup et al. (1995) studied these questions on the
basis of polymorphism of 7 microsatellite loci (B124, A7, A24, A113,
A28, A88, A43), and P.Franck et al. (1998, 2000) based on an assessment
of polymorphism 8 microsatellite loci in different European countries,
P.De La Rua et al. (2002) - based on the assessment of polymorphism 8
microsatellite loci in the North-East of Italy, A.Jensen et al. (2005)
- 11 microsatellite loci in Norway, Sweden, Denmark, Scotland, England,
Ireland. In our laboratory R.A.Ilyasov (2006) and Ilyasov et al., 2006,
2007, 2008, based on microsatellite loci polymorphism 2 (Ap243, 4a110)
studied the genetic variability of bee populations in the South and
Middle Urals, on the territory of the Republic of Bashkortostan and the
Perm edge .
DNA
sequencing was also a frequently used method in population genetic
studies of bees. J.-M.Cornuet et al. (1991) sequenced intergenic locus
COI-COII mtDNA bees and showed differences Ammellifera from other
subspecies. After the invention of the automatic sequencer made
available sequencing of a large number of samples in a relatively short
time. MCArias, WSSheppard (1996) on the basis of the gene sequencing
fragment ND2 Ammellifera mtDNA showed no difference from other
subspecies of bees in Europe. In our laboratory R.A.Ilyasov et al.
(2006) based on the sequencing of the gene fragment ND2 mtDNA showed
differences Ammellifera from the southern subspecies of bees on the
territory of the Urals republic of Bashkortostan. Most recently, the
staff of the consortium for sequencing the genome sequenced the entire
genome of bee honey bee and showed differences between Ammellifera and
other subspecies (Weinstock et al., 2006). It was shown that subtype
Amiberica very similar to Ammellifera and cluster analysis are grouped
together.
The
most novel and promising method of genetic analysis is the study of
bees polymorphism SNP (single nucleotide polymorphism), based on which
it will be possible to make genetic passport bees very quickly and
cheaply identify subspecies of bees and phylogenetic pattern. Today,
for the honeybee are several thousand SNP (Whitfield et al., 2006).
The
study of genetic variation in the population of bees of the Urals and
the Volga region was performed using about 10 genetic markers. It was
found that the bees do not all have significant polymorphism markers.
So ap049 microsatellite loci in the population of bees Bashkortostan
had very little polymorphism in the future has not been used. Also
absent length polymorphism in mtDNA genes ND2, COI mtDNA and intron of
EF1-α nuclear DNA - they observed SNP polymorphism, which is
detected
only by sequencing. Polymorphisms of these genes are also partly
revealed by restriction endonuclease DraI. Significant polymorphism had
all the other microsatellite loci - ap243, 4a110, A8, A113 nuclear DNA.
Very interesting polymorphism observed in intergenic locus COI-COII
mtDNA, where we discovered the existence of four haplotypes (Q, PQ, PQQ
and PQQQ). In addition, the bee population of the Urals and the Volga
is a polymorphic gene defensin antimicrobial peptides (Lviv, 2002). It
was found that for the majority of bee populations, where there is no
mass import of families there is some percentage of inbreeding, while
the populations in which the bees are imported from outside, there is
outbreeding. According to the research it published a number of papers
in the journals "Beekeeping" and "Genetics".
Laboratory
of Biochemistry adaptability insects Institute of Biochemistry and
Genetics, Ufa Scientific Center, Russian Academy of Sciences is
interested in expanding the area of research and the number of loci
analyzed bees, and in collaboration with major private and beekeeping
farms. According to the results of tests we can provide information on
genetic structure, subspecies composition, direction and progress of
the genetic processes of evolutionary transformations studied apiaries. |
048.
Ильясов
Р.А., Шареева З.В., Кутлин Н.Г., Поскряков А.В., Николенко А.Г.
Пчеловодство северных районов республики Башкортостан. Материалы
международной научно-практической конференции "Биологические науки в
XXI веке". Бирск. 2008. С. 190-194.
Анализируя
состояние генофонда среднерусских пчел, Кривцов Н.И. (2005) считает,
что основания для тревоги есть, но положение не столь драматично. В
Западной Европе вытеснение темной лесной пчелы началось еще раньше
(около 150 лет назад) и шло интенсивнее, чем в России, тем не менее, в
некоторых странах Западной Европы еще сохранились популяции темной
европейской пчелы Apis mellifera mellifera. Для улучшения сложившейся
ситуации, по мнению Кривцова Н.И., необходимо поставить вопрос о
создании совета по пчеле среднерусской расы в рамках
селекционно-информационного центра при НИИ пчеловодства.
Вопрос о
сохранении
аборигенной пчелы в первую очередь связан с ее преимуществами перед
гибридными. Среднерусские пчелы обладают более высокой зимостойкостью,
меньше реагируют на резкие колебания температуры. Весеннее развитие
пчелиных семей начинается немного позже, а затем ее интенсивность
быстро нарастает. По медопродуктивно-сти среднерусские пчелы в условиях
бурного медосбора с липы, гречихи, вереска и других медоносов
превосходят гибридных, испытываемых в этих условиях. Они обладают
хорошей воскопродуктивностью и способностью приносить много пыльцы.
По данным
Р.А.Ильясова с
соавт. (2006) на Урале сохранились резерваты Apis mellifera mellifera
L. в Бурзянском и Татышлинском районах Республики Башкортостан и
Пермском крае. Мы решили продолжить поиск сохранившихся локальных
популяций и задались целью исследовать для начала три северных района
Республики Башкортостан: Бирский, Мишкинский и Караидельский. Интересен
тот факт, что по результатам Саттарова В.Н. (2000) в Бирском районе в
СПК «Ленина» более 50% пчел являлись гибридными.
Бирский,
Мишкинский и
Караидельский районы относятся к лесостеп-ной зоне северной подзоне
Республики Башкортостан. Данная местность имеет облесенность от 25 до
70%, массивы которой представлены елово-пихтово-сосновым древостоем с
примесью широколиственных: липы, березы, осины. Период медосбора
недолгий, главный - приходится на июль. Безоблетное время длится до
шести месяцев. Многие пчеловоды предпочитают зимовку на улице. В
подобных условиях гибридным пчелам выжить нелегко (Власов, 1983).
По словам
начальника
Бирского межрайонного объединения (МРО) пчеловодства Н.М.Фаттахова
(2008) пчеловодство в наших районах насчи-тывает многолетнюю историю.
Люди занимались пчеловодством еще до ре-волюции, в том числе и во всех
существующих монастырях. В период коллективизации многие пасеки были
объединены в крупные колхозные. Для их обслуживания в северной зоне в
1948 году было организовано Бирское МРО пчеловодства. Позже были
организованы Мишкинское и Караидельское МРО. Общее руководство
пчеловодством осуществляла Башпчелоконтора при МСХ БАССР. Всего по
Башкирии было 4 МРО: Уфимское, Стерлитамакское, Бирское и Туймазинское.
Каждое из них обслуживало 14 районов.
В 1960-1970гг.
был
массовый завоз серых горных кавказских пчел в северные районы
Республики Башкортостан для опытных целей, что позднее было запрещено.
В эти годы пчеловодству уделялось большое внимание со стороны
правительства. Было организовано производство ульев, построен
воскоперерабатывающий завод. Каждую зиму с пчеловодами хозяйств
проводилась учеба по повышению квалификации, для чего была создана
школа пчеловодства, работала Башкирская опытная станция пчеловодства.
По данным Власова
В.Н.
(1983) в 1970-80гг. была налажена хорошая работа на матковыводных
пасеках (1,5-2 тыс. маток) Мишкинского района. На пасеках
Караидельского района проводилось испытание и использование дочерей от
рекордисток и это показало, что такая селекция способствует улучшению
полезных признаков местных пчел и обеспечивает устойчивую
медопродуктивность рядовых пасек в последующие годы. От уровня
племен-ной работы зависели качество семей и товарность пасек,
увеличение производства высококачественного башкирского целебного меда.
Во времена
перестройки
многие колхозные пасеки были распроданы, зоотехнические службы
–
расформированы. Появились новые заготовители. МРО утратило свои позиции
за отсутствием оборотных средств. С конца 2006 года каждый район
работает самостоятельно. По мнению Фаттахова Н. М., настоящее время
– время частного пчеловодства, что снижает возмож-ность
контроля
свыше, но не мешает анализировать их состояние.
Для исследований
были
отобраны пчелы с 42 пасек трех районов, не менее чем из 25% пчелосемей
с пасеки. С каждой семьи брали по 5 рабочих особей, которых фиксировали
в 96% этаноле и хранили в морозильной камере. ДНК выделяли из
летательных мышц пчел по методу смесью
гуанидинтиоционат-фенол-хлороформ (Chomezynski, Sacchi, 1987).
В анализе
популяций в
качестве генетического маркера использовали межгенный локус COI-COII
мтДНК, полиморфизм которого был установлен ранее у представителей
разных подвидов Apis mellifera (Cornuet et al., 1991). А.Г.Николенко и
А.В.Поскряков (1998) ранее использовали этот полиморфизм в качестве
маркера для различения подвидов A.m.mellifera и A.m.caucasica (Ильясов
Р.А., 2006). Этот маркер был использован нами для поиска популяций
A.m.mellifera.
Полимеразную
цепную
реакцию (ПЦР) проводили в термоциклере «Циклотерм»
при
оптимальном для каждого локуса температурном режиме. Выделенную ДНК
проверяли на качество в агарозном геле и а продукты ПЦР
электрофоретически фракционировали в полиакриламидном геле, после чего
окрашивали бромистым этидием и фотографировали в трансиллюминаторе.
По исследуемым
нами
районам (Бирский, Мишкинский, Караидель-ский) анализ полиморфного
межгенного локуса COI-COII мтДНК показал, что частота комбинации PQQ,
характеризующего пчелу среднерусской расы, более 90%. Полученные нами
данные позволяют говорить о сохранении среднерусских пчел в данных
районах, куда ранее были завезены пчелы других подвидов из южных
регионов России. Это позволяет предположить возможность восстановления
аборигенного генофонда под воздействием факторов окружающей среды, куда
можно включить и антропогенные факторы.
В настоящее время
нами
проводятся сравнительные популяционно-генетические исследования
выделенных популяций с изучением полимор-физма микросателлитных локусов
ядерного генома, так как митохондриаль-ная ДНК позволяет судить лишь о
материнской наследственности.
Analyzing the
gene pool
of the Central Russian bees NI Krivtsov (2005) believes that there is
cause for concern, but the situation is not so dramatic. In Western
Europe, the displacement of the dark forest bees started even earlier
(about 150 years ago) and went harder than in Russia, however, in some
countries of Western Europe are still preserved populations dark
European bee Apis mellifera mellifera. To improve the situation,
according to NI Krivtsov, you must raise the question of the
establishment of the Board of the Central Russian bee races in the
framework of breeding and information center at the Institute of
beekeeping.
The issue of
preservation of native bees in the first place associated with its
advantages over hybrid. Central Russian bees have higher winter
hardiness, less responsive to rapid changes in temperature. The spring
development of bee colonies begins a little later, and then its
intensity rapidly increases. By Medoproduktivnost-sti Central Russian
bees in terms of rapid medosbora with lime, buckwheat, heather honey
plants and other superior hybrid tested in these conditions. They have
a good voskoproduktivnostyu and the ability to bring a lot of pollen.
According
R.A.Ilyasova
et al. (2006) Urals preserved reserves Apis mellifera mellifera L. in
Burzyan and Tatyshlinskom areas of the Republic of Bashkortostan and
the Perm region. We decided to continue the search for the remaining
local populations and set out to explore to begin the three northern
region of the Republic of Bashkortostan: Birsky, Mishkinskoye and
Karaidelsky. An interesting fact is that the results Sattarova VN
(2000) Birsk area in the SEC "Lenin" over 50% of the bees is a hybrid.
Birsky,
Mishkinskoye and
Karaidelsky areas are forest-steppe zone of the North-term sub-zone of
the Republic of Bashkortostan. The area has a forest cover of 25 to
70%, which shows arrays spruce-fir-pine stands with an admixture of
deciduous: linden, birch, aspen. Medosbora short period, the main - is
in July. Bezobletnoe time lasts up to six months. Many beekeepers
prefer to winter in the street. In such circumstances the hybrid bees
to survive is not easy (Vlasov, 1983).
According to the
head of
interdistrict Birsk Association (MPO) Beekeeping N.M.Fattahova (2008)
Beekeeping in our neighborhoods naschi Pipeline long history. People
engaged in beekeeping before re-revolution, including all existing
monasteries. During the period of collectivization, many apiaries were
merged into large collective farms. For their service in the northern
zone in 1948 it was organized by the MPO Birsk beekeeping. Later they
were organized and Mishkinskoye Karaidelskoe MPO. The general
management of beekeeping in the Ministry of Agriculture carried out
Bashpchelokontora BASSR. Total Bashkiria was 4 MPO: Ufa, Sterlitamak,
and Birsk Tuymazinskoe. Each of them served 14 districts.
In 1960-1970gg.
It was a
massive importation of gray mountain Caucasian bees in the northern
areas of the Republic of Bashkortostan for power purposes, which was
later banned. During these years, beekeeping has received considerable
attention from the government. It organized the production of beehives
built voskopererabatyvayuschy plant. Every winter, beekeepers
households conducted studies on professional development, which has
created a school of beekeeping, worked Bashkir beekeeping Experiment
Station.
According to
Vlasov, VN
(1983) in 1970-80gg. was arranged a good job on matkovyvodnyh apiaries
(1,5-2 thousand. queens) Mishkinsky area. On apiaries Karaidelskogo
District conducted testing and use of the daughters of rekordistok and
it showed that this helps to improve the selection of useful traits of
local bees and provides a stable medoproduktivnost ordinary apiary in
the following years. From the level of tribes-term quality of the work
depended families and marketability of apiaries, increasing the
production of high-quality curative Bashkir honey.
During
perestroika, many
kolkhoz apiary were sold, livestock Service - disbanded. There are new
collectors. MPO has lost its position in the absence of working
capital. Since late 2006, each district operates independently.
According Fattakhova NM, is now - time private beekeeping, which
reduces the possibility of control over, but does not prevent analyze
their condition.
For the study
were
selected from 42 apiaries bee three areas of at least 25% of bee
colonies from the apiary. Each family took 5 working specimens which
were fixed in 96% ethanol and stored in a freezer. DNA was isolated
from muscle flying bee method guanidintiotsionat mixture
phenol-chloroform (Chomezynski, Sacchi, 1987).
In the analysis
of the
population as a genetic marker used intergenic locus COI-COII mtDNA
polymorphisms which was previously set at representatives of different
subspecies of Apis mellifera (Cornuet et al., 1991). A.G.Nikolenko and
A.V.Poskryakov (1998) have previously used this polymorphism as a
marker to distinguish between subspecies and Ammellifera Amcaucasica
(Ilyasov RA 2006). This marker was used to search for our populations
Ammellifera.
Polymerase chain
reaction (PCR) was performed in a thermal cycler "Tsikloterm" at the
optimum temperature for each locus mode. The isolated DNA was checked
on quality agarose gel and PCR products were fractionated
electrophoretically in a polyacrylamide gel, then stained with ethidium
bromide and photographed in transilluminator.
In the studied
areas
(Birsky, Mishkinskoye, Karaidel-sky) an analysis of polymorphic
intergenic locus COI-COII mtDNA showed that the frequency combination
of PQQ, which characterizes Central Russian bee race, more than 90%.
Our data suggest the Central Russian bees in maintaining these areas,
where the bees were brought before other subspecies of the southern
regions of Russia. This suggests the possibility of restoring the
indigenous gene pool under the influence of environmental factors,
which can be switched on and anthropogenic factors.
Currently, we
carry out
a comparative population genetic studies dedicated to the study of
population polymorphism-phism microsatellite loci of the nuclear
genome, as mitochondrial DNA Nye gives an indication only of maternal
inheritance. |
047.
Ильясов
Р.А., Шареева З.В., Кутлин Н.Г., Поскряков А.В., Николенко А.Г.
Генетический полиморфизм в популяциях пчел Урала и Поволжья. Материалы
международной научно-практической конференции "Биологические науки в
XXI веке". Бирск. 2008. С. 23-27.
Первоначальные
исследования генофонда пчел с использованием метода RFLP (полиморфизма
длин рестрикционных фрагментов) проводились на тотальной
митохондриальной ДНК (мтДНК). D.R.Smith, W.M.Brown (1988) показали
генетические различия подвида A.m.mellifera от африканизированных пчел
в США методом RFLP мтДНК эндонуклеазами BcII, EcoRI, NdeI, XbaI.
Открытие PCR (полимеразной цепной реакции) в 80-х годах (Mullis et al.,
1994) сделало возможным изучение полиморфизма ДНК и привело к революции
в области молекулярной биологии. В результате для изучения полиморфизма
в популяциях пчел стали использовать модифицированный вариант RFLP, где
происходит рестрикция амплифицированных фрагментов ДНК. H.G.Hall,
D.R.Smith (1991) на основе RFLP анализа амплифицированных фрагментов
генов CO-I и CO-II эндонуклеазами EcoRI, HincII, Xba I показали уровень
генетической вариабельности популяции пчел Испании. На основе RFLP
анализа амплифицированногго фрагмента межгенного локуса COI-COII мтДНК
с использованием эндонуклеазы DraI была изучена генетическая структура
популяции пчел Франции (Franck et al., 1998), Италии (Franck et al.,
2000), Норвегии, Швеции, Дании, Шотландии, Англии, Ирландии (Jensen et
al., 2005).
Параллельно с методом модифицированной RFLP в изучении генома пчел
развивался метод RAPD (полиморфизм длин амплифицированных фрагментов со
случайно выбранными праймерами). Метод RAPD нашел применение в
исследованиях генома медоносной пчелы (Чудинов, 1999). С использованием
метода RAPD G.J.Hunt и R.E.Page (1995) составили 26 групп сцепления и
картировали гены определения пола, цвета тела и малат дегидрогеназы
пчел.
Помимо метода RAPD в популяционных исследованиях пчел использовалась
аллель-специфичная PCR. В нашем институте был разработан метод
идентификации подвида A.m.mellifera на Урале в Республике Башкортостан
на основе электрофоретического разделения в агарозном геле
амплифицированных локусов межгенного локуса COI-COII мтДНК. Наша
лаборатория также проводила поиск популяций подвида
A.m.mellifera
на Южном и Среднем Урале на территории республики Башкортостан и
Пермского края с ипользованием полиморфизма межгенного локуса COI-COII
мтДНК (Сатаров, Николенко, 2000; Николенко, Поскряков, 2002) в
результате чего были выделены сохранившиеся популяции
A.m.mellifera (Ильясов, 2005; Ильясов с соавт., 2006, 2007,
2008).
Методика изучения генетического полиморфизма популяций пчел на основе
полиморфизма SSR (микросателлитных локусов) основана также на
аллель-специфичной PCR. В последнее время полиморфизм микросателлитных
локусов широко используется во всем мире в изучении генетической
структуры и уровня вариабельности популяций пчел разными
исследователями. Так A.Estoup et al. (1995) изучал эти вопросы на
основе полиморфизма 7 микросателлитных локусов (B124, A7, A24, A113,
A28, A88, A43), а P.Franck et al. (1998, 2000) на основе оценки
полиморфизма 8 микросателлитных локусов в разных странах Европы, P.De
La Rua et al. (2002) - на основе оценки полиморфизма 8 микросателлитных
локусов в Северо-Восточной Италии, A.Jensen et al. (2005) - 11
микросателлитных локусов в Норвегии, Швеции, Дании, Шотландии, Англии,
Ирландии. В нашей лаборатории Р.А.Ильясов (2006) и Ильясов с соавт.,
2006, 2007, 2008 на основе полиморфизма 2 микросателлитных локусов
(Ap243, 4a110) изучили генетическую вариабельность популяций пчел на
Южном и Среднем Урале на территории Республики Башкортостан и Пермского
края.
Секвенирование ДНК также является часто используемым методом в
популяционно-генетических исследованиях пчел. J.-M.Cornuet et al.
(1991) просеквенировали межгенный локус COI-COII мтДНК пчел и показали
различия A.m.mellifera от других подвидов. После изобретения
автоматического секвенатора стало доступным секвенирование большого
количества образцов за сравнительно короткое время. M.C.Arias,
W.S.Sheppard (1996) на основе секвенирования фрагмента гена ND2 мтДНК
показали различия A.m.mellifera от других подвидов пчел в Европе. В
нашей лаборатории Р.А.Ильясов с соавт. (2006) на основе секвенирования
фрагмента гена ND2 мтДНК показали различия A.m.mellifera от южных
подвидов пчел на Урале на территории республики Башкортостан. Совсем
недавно сотрудники консорциума по секвенированию генома пчелы
просеквенировали весь геном медоносной пчелы и показали различия между
A.m.mellifera и другими подвидами (Weinstock et al., 2006). Было
показано, что подвид A.m.iberica очень сходен с A.m.mellifera и при
кластерном анализе группируются вместе.
Самым новым и многообещающим методом генетической анализа пчел является
изучение полиморфизма SNP (однонуклеотидного полиморфизма), на основе
чего можно будет составить генетический паспорт пчелы, очень быстро и
дешево определить подвидовую принадлежность пчел и филогенетический
паттерн. На сегодняшний день для медоносной пчелы известно несколько
тысяч SNP (Whitfield et al., 2006).
Изучение генетической вариабельности в популяции пчел Урала и Поволжья
было выполнено с использованием порядка 10 генетических маркеров.
Оказалось, что пчелы не по всем маркерам обладают значительным
полиморфизмом. Так микросателлитный локус ap049 в популяции пчел
Башкортостана обладал очень незначительным полиморфизмом и в дальнейшем
не был использован. Также отсутствовал полиморфизм длины у генов ND2
мтДНК, COI мтДНК и интрона гена EF1-α ядерной ДНК –
у них
наблюдается SNP полиморфизм, который выявляется только секвенированием.
Полиморфизм этих генов также частично выявляется рестрикцией
эндонуклеазой DraI. Значительным полиморфизмом обладали все остальные
микросателлитные локусы – ap243, 4a110, A8, A113 ядерной ДНК.
Очень интересный полиморфизм наблюдался у межгенного локуса COI-COII
мтДНК, где мы обнаружили существование 4 гаплотипов (Q, PQ, PQQ и
PQQQ). Кроме того, в популяции пчел Урала и Поволжья полиморфным
является ген антибактериального пептида дефензина (Львов, 2002).
Оказалось, что для большинства популяций пчел, где не происходит
массовый ввоз семей, наблюдается некоторая доля инбридинга, тогда как в
популяциях, в которые завозят пчел извне, наблюдается аутбридинг. По
результатам исследований было опубликовано ряд работ в журналах
«Пчеловодство» и «Генетика».
Лаборатория биохимии адаптивности насекомых Института биохимии и
генетики Уфимского НЦ РАН заинтересована в расширении ареала
исследований и числа анализируемых локусов пчел, а также в
сотрудничестве с крупными и частными пчеловодными хозяйствами. По
результатам тестов мы можем предоставить данные о генетической
структуре, подвидовом составе, направлении генетических процессов и
ходе эволюционных преобразований исследуемых пасек.
Initial studies of the gene pool of bees using the method of RFLP
(restriction fragment length polymorphism) were carried out on a total
of mitochondrial DNA (mtDNA). DRSmith, WMBrown (1988) have shown
genetic differences Ammellifera subspecies of Africanized honey bees in
the United States by mtDNA RFLP endonucleases BcII, EcoRI, NdeI, XbaI.
Opening of PCR (polymerase chain reaction) in 80 years (Mullis et al.,
1994) has made it possible to study DNA polymorphism and led to a
revolution in the field of molecular biology. As a result of studying
polymorphism in bee populations started using a modified version of
RFLP, where the restriction of the amplified DNA fragments. HGHall,
DRSmith (1991) based on RFLP analysis of the amplified gene fragments
CO-I and CO-II endonuclease EcoRI, HincII, Xba I showed a level of
genetic variability bee population Spain. On the basis of RFLP fragment
analysis amplifitsirovannoggo intergenic locus COI-COII mtDNA with
endonuclease DraI was studied genetic structure of the population of
bees in France (Franck et al., 1998), Italy (Franck et al., 2000),
Norway, Sweden, Denmark, Scotland, England, Ireland (Jensen et al.,
2005).
In parallel with the modified RFLP method in studying the genome of
bees developed technique RAPD (amplified fragment length polymorphism
with randomly selected primers). RAPD method has been applied in the
study of the genome of the honey bee (Chudinov, 1999). Using the method
of RAPD GJHunt and REPage (1995) amounted to 26 linkage groups and
mapped the genes of sex determination, the color of the body and malate
dehydrogenase bees.
In addition to the RAPD method in population studies of bees used
allele-specific PCR. Our institute has been developed a method of
identifying subspecies Ammellifera the Urals in the Republic of
Bashkortostan on the basis of electrophoretic separation in an agarose
gel of amplified loci intergenic locus COI-COII mtDNA. Our laboratory
also conducted search Ammellifera subspecies populations in the South
and Middle Urals, on the territory of the Republic of Bashkortostan and
the Perm edge programs included with polymorphism intergenic locus
COI-COII mtDNA (Satarov, Nikolenko, 2000; Nikolenko, Poskryakov, 2002)
resulting in the marked surviving populations Ammellifera (Ilyasov,
2005; Ilyasov et al., 2006, 2007, 2008).
Method for studying the genetic polymorphism of bee populations on the
basis of polymorphism SSR (microsatellite loci) is also based on
allele-specific PCR. Recently, a polymorphism of microsatellite loci
are widely used around the world in the study of the genetic structure
and the level of variability of bee populations by different
researchers. Thus A.Estoup et al. (1995) studied these questions on the
basis of polymorphism of 7 microsatellite loci (B124, A7, A24, A113,
A28, A88, A43), and P.Franck et al. (1998, 2000) based on an assessment
of polymorphism 8 microsatellite loci in different European countries,
P.De La Rua et al. (2002) - based on the assessment of polymorphism 8
microsatellite loci in the North-East of Italy, A.Jensen et al. (2005)
- 11 microsatellite loci in Norway, Sweden, Denmark, Scotland, England,
Ireland. In our laboratory R.A.Ilyasov (2006) and Ilyasov et al., 2006,
2007, 2008, based on microsatellite loci polymorphism 2 (Ap243, 4a110)
studied the genetic variability of bee populations in the South and
Middle Urals, on the territory of the Republic of Bashkortostan and the
Perm edge .
DNA sequencing was also a frequently used method in population genetic
studies of bees. J.-M.Cornuet et al. (1991) sequenced intergenic locus
COI-COII mtDNA bees and showed differences Ammellifera from other
subspecies. After the invention of the automatic sequencer made
available sequencing of a large number of samples in a relatively short
time. MCArias, WSSheppard (1996) on the basis of the gene sequencing
fragment ND2 Ammellifera mtDNA showed no difference from other
subspecies of bees in Europe. In our laboratory R.A.Ilyasov et al.
(2006) based on the sequencing of the gene fragment ND2 mtDNA showed
differences Ammellifera from the southern subspecies of bees on the
territory of the Urals republic of Bashkortostan. Most recently, the
staff of the consortium for sequencing the genome sequenced the entire
genome of bee honey bee and showed differences between Ammellifera and
other subspecies (Weinstock et al., 2006). It was shown that subtype
Amiberica very similar to Ammellifera and cluster analysis are grouped
together.
The most novel and promising method of genetic analysis is the study of
bees polymorphism SNP (single nucleotide polymorphism), based on which
it will be possible to make genetic passport bees very quickly and
cheaply identify subspecies of bees and phylogenetic pattern. Today,
for the honeybee are several thousand SNP (Whitfield et al., 2006).
The study of genetic variation in the population of bees of the Urals
and the Volga region was performed using about 10 genetic markers. It
was found that the bees do not all have significant polymorphism
markers. So ap049 microsatellite loci in the population of bees
Bashkortostan had very little polymorphism in the future has not been
used. Also absent length polymorphism in mtDNA genes ND2, COI mtDNA and
intron of EF1-α nuclear DNA - they observed SNP polymorphism,
which is detected only by sequencing. Polymorphisms of these genes are
also partly revealed by restriction endonuclease DraI. Significant
polymorphism had all the other microsatellite loci - ap243, 4a110, A8,
A113 nuclear DNA. Very interesting polymorphism observed in intergenic
locus COI-COII mtDNA, where we discovered the existence of four
haplotypes (Q, PQ, PQQ and PQQQ). In addition, the bee population of
the Urals and the Volga is a polymorphic gene defensin antimicrobial
peptides (Lviv, 2002). It was found that for the majority of bee
populations, where there is no mass import of families there is some
percentage of inbreeding, while the populations in which the bees are
imported from outside, there is outbreeding. According to the research
it published a number of papers in the journals "Beekeeping" and
"Genetics".
Laboratory of Biochemistry adaptability insects Institute of
Biochemistry and Genetics, Ufa Scientific Center, Russian Academy of
Sciences is interested in expanding the area of research and the
number of loci analyzed bees, and in collaboration with major private
and beekeeping farms. According to the results of tests we can provide
information on genetic structure, subspecies composition, direction and
progress of the genetic processes of evolutionary transformations
studied apiaries. |
046.
Ильясов Р.А.,
Комиссар А.Д., Поскряков А.В., Николенко А.Г. Украинские пчелы -
уникальный подвид или экотип македонских пчел? Пчеловодство. № 1. 2008.
С. 10-11
Украинские
пчелы - уникальный подвид или экотип македонских пчел? (Ukrainian bees
- are unique subspecies or ecotype Macedonian bees? Russian journal of
beekeeping)
Образцы пчел A. m. ligustica из Италии разделились на две группы, одна
из которых была близка к группе A. m. macedonica, а другая находилась
на значительном отдалении от A. m. macedonica и А. т. carnica и была
близка к А. т. mellifera. Согласно результатам исследований
морфометрических характеристик пчелы из Италии обладали большим
сходством с A. m. carnica из Австрии и Югославии (Ruttner, 1988).
Возможно, некоторые популяции A. m. ligustica из Италии пересекались с
пчелами A. m. mellifera из Франции, что подтверждает полиморфизм
межгенно- го локуса COI-COII мтДНК (Franck et al., 2000).
Исходя из сравнительного анализа нуклеотидных последовательностей
фрагмента гена ND2 мтДНК можно считать, что исследованные образцы
украинских пчел относятся к подвиду A. m. macedonica, и исключить
предположения о том, что они — южная ветвь среднерусских пчел
A.
m. mellifera. Вероятно, краинские A. m. carnica и македонские А. т.
macedonica пчелы по отношению друг к другу являются подвидами, а не
экотипами, что противоречит гипотезе В.Губина (1977) о том, что
украинские пчелы могут быть одной из популяций A. m. carnica.
Полученные данные — еще одно подтверждение гипотезы
Ф.Руттнера
(1988) о возможной принадлежности украинских пчел к македонским A. m.
macedonica, то есть мы имеем украинскую локальную популяцию A. m.
macedonica с возможным названием Apis mellifera macedonica var.
ukrainica (предложение А.Д.Комиссара, 2005).
Samples bees A. m. ligustica from Italy were divided into two groups,
one of which was close to the group A. m. macedonica, while others are
at a considerable distance from A. m. macedonica and A. m. carnica and
was close to A. m. mellifera. According to the research of morphometric
characteristics of bees from Italy have much in common with A. m.
carnica from Austria and Yugoslavia (Ruttner, 1988). Perhaps some
populations of A. m. ligustica from Italy crossed with bees A. m.
mellifera from France, which confirms mezhgenno- polymorphism locus of
mtDNA COI-COII (Franck et al., 2000).
Based on the comparative analysis of the nucleotide sequences of mtDNA
ND2 gene fragment can be assumed that the samples studied Ukrainian
bees belong to the subspecies A. m. macedonica, and exclude the
assumption that they - the southern branch of the Central Russian bees
A. m. mellifera. Probably Krajina A. m. carnica and Macedonian A. m.
macedonica bees in relation to each other is a subspecies, not
ecotypes, which contradicts the hypothesis V.Gubina (1977) that the
Ukrainian bees can be one of the populations of A. m. carnica. The
obtained data - yet another confirmation of the hypothesis of F.Ruttner
(1988) about a possible accessory to the Macedonian Ukrainian bees A.
m. macedonica, that is, we have a local Ukrainian population of A. m.
macedonica with possible name Apis mellifera macedonica var. ukrainica
(offer A.D.Komissar, 2005).
Publication Name: Ilyasov R.A., Commissar A.D., Poskryakov A.V.
Nikolenko A.G. Ukrainian bees - are unique subspecies or ecotype
Macedonian bees? Russian journal of beekeeping. V. 1. 2008. P. 10-11. |
045.
Ильясов Р.А.,
Петухов А.В., Колбина Л.М., Поскряков А.В., Николенко А.Г.Структура
генофонда популяций медоносной пчелы Урала и Поволжья. Материалы
международной конференции "Пчеловодство - XXI века". Москва. 2008.
С.212-214.
Одной
из наиболее интересных для человека групп насекомых являются пчелы -
свыше 16000 современных видов (Danforth et al., 2006), но только вид
Apis mellifera L. стал широко использоваться человеком в
сельскохозяйственном разведении во всем мире.
Обширный
естественный ареал медоносной пчелы охватывает всю Африку, Европу и
Ближний Восток. Следствием этого явилась значительная внутривидовая
дифференциация (Ruttner, 1988), на данный момент общепризнано
существование 25 подвидов. На территории Европы известно существование
9 подвидов A.mellifera, 8 из которых обитает в Южной и Центральной
Европе. Только 1 подвид Apis mellifera mellifera L. (темная
европейская, темная лесная, она же среднерусская пчела) освоил
лесостепную и лесную зоны Северной Европы, что делает его очень ценным
для пчеловодства в северных странах. Ещё двести лет назад этот подвид
занимал в Евразии огромную территорию вдоль северной границы
естественного ареала вида. Эволюция его протекала в суровых
климатических условиях, в результате чего выработалась исключительная
зимостойкость и устойчивость к таким заболеваниям, как нозематоз,
гнилец, падевый токсикоз. В результате массового завоза пчел из южных
районов в лесную и лесостепную зоны России, прежний ареал пчелы
среднерусской расы оказался заселен в основном пчёлами гибридного
происхождения.К сожалению, в результате непрерывного импорта пчел с юга
в северные регионы произошла массовая гибридизация пчёл. В Германии
массивный импорт A.m.carnica в 1840-х годах привел почти к полной
замене местных пчел A.m.mellifera (Maul, Hahnle, 1994). В скандинавских
странах и на Британских островах на большей части территории также
вместо аборигенных пчел A.m.mellifera разводят A.m.ligustica и
A.m.carnica (Cooper 1986; Dews, Milner 1991; Jensen et al., 2005).
Такая же ситуация сложилась и в России.
Одним
из основных условий сохранения генофонда являются методы его чёткой
идентификации (Daly et al., 1991). Первоначально для этого
использовался только анализ морфометрических признаков. Его основу
заложил Г.А.Кожевников (1900), который сделал промеры длины хоботка
пчел и предложил методику измерения их хитиновых частей. Современная
морфометрическая классификация A.mellifera основывается на работах
G.Goetze (1940), В.В.Алпатова (1948) и F.Ruttner et al. (1978).
F.Ruttner (1988, 1992) с использованием мультивариантного анализа
морфометрических признаков разработал метод отличения A.m.mellifera от
других европейских подвидов, однако не смог найти четких
морфометрических различий между A.m.iberica и A.m.mellifera.
Н.И.Кривцов (1998) в своей работе представил стандарты размеров частей
тела для подвида A.m.mellifera, используя которые можно довольно точно
определить подвидовую принадлежность. Также стандарты морфометрии были
получены в нашей лаборатории для подвида A.m.mellifera башкирской
популяции (Саттаров, Николенко, 2002). Однако стало известно, что
морфометрические методы часто не позволяют точно идентифицировать
подвиды из-за сильной зависимости морфометрических характеристик пчел
от условий окружающей среды и уровня внутривидовой гибридизации
(Guzman-Novoa et al., 1994).
Впоследствии
большинство исследователей пчел стало переходить на использование
молекулярных маркеров, дающих более точные, однозначно интерпретируемые
результаты по сравнению с морфометрическими методами. В нашем институте
разработана методика быстрой PCR-идентификации подвида A.m.mellifera в
Республике Башкортостан на основе полиморфизма межгенного локуса
COI-COII мтДНК. Для определения подвидовой принадлежности популяции
пчел был использован метод на основе определения полиморфизма
межгенного локуса COI-COII митохондриальной ДНК, комбинация PQQ
которого характеризует происхождение пчел от A.m.mellifera по
материнской линии. Всего было проанализировано 69 семей пчел с 11 пасек
Удмуртии, 144 семей с 11 пасек Пермского края и 406 семей 9 пасек
Республики Башкортостан.
Результаты
показали, что на части пасек Удмуртии преобладали семьи имеющие
происхождение от A.m.mellifera. Частота пчел происходящих от
A.m.mellifera была очень высокой на некоторых пасеках Камбарского,
Глазовского, Можгинского, районов Удмуртии. В Мало-Пургинском,
Шарканском и Завьяловском районах Удмуртии частота пчел происходящих от
A.m.mellifera оказалась довольно низкой, что свидетельствует о завозе
пчел южных подвидов. Найденные нами пасеки с высоким содержанием пчел
происходящих от A.m.mellifera на территории Татышлинского района
республики Башкортостан, возможно, являются сохранившейся частью
янаульской популяции A.m.mellifera. Практически на всей территории
Пермского края было обнаружено множество пасек с большинством семей,
происходящих от A.m.mellifera. Эти пасеки расположены на территории
Красновишерского, Нытвенского, Ординского, Частинского, Пермского,
Осинского районов Пермского края. На территории Уинского района
пермского края часть семей пчел имело гибридное происхождение.
Возможно, что произошла некоторая степень гибридизации благодаря потоку
генов извне в эти пасеки. Пчелы, обитающие на всей остальной
территории, между изученными нами локальными популяциями, по ранним
нашим исследованиям (Николенко, Поскряков, 2002), были интенсивно
гибридизованы с завозными южными подвидами.
Таким
образом, обнаруженные нами пасеки с высокой частотой встречаемости
семьей пчел, имеющих происхождение от A.m.mellifera, позволяют говорить
о сохранении на Урале локальных популяций темной лесной или
среднерусской пчелы. Генетическая структура популяций пчел на Урале и
Поволжье очень сложная, прерывистая и фрагментированная. Нет большого
непрерывного массива генофонда пчел, происходящих от темной лесной
пчелы, а островная модель популяции, описанная в 1969 году С. Райтом,
оказалась для них очень подходящей. Между локальными популяциями
происходит непрерывный поток генов как под воздействием антропогенных,
так и естественных внутрипопуляционных факторов. Благодаря некоторой
степени изоляции между ними происходит процесс дивергенции, что
приводит к накоплению в популяции пчел происходящих от A.m.mellifera
генетического разнообразия и тем самым повышает его устойчивость к
факторам окружающей среды. Для сохранения популяции пчел, происходящих
от A.m.mellifera, на Урале и Поволжье необходимо сохранить генофонд
каждой из обнаруженных нами локальных популяций в чистоте и
определенной изоляции от потока генов из популяций пчел гибридного
происхождения.
One
of the most interesting groups of insects are human bees - more than
16,000 modern species (Danforth et al., 2006), but just kind of Apis
mellifera L. was widely used by man in the agricultural cultivation
worldwide.
Extensive
natural range honeybee covers the whole of Africa, Europe and the
Middle East. The result was significant intraspecific differentiation
(Ruttner, 1988), at the moment it is generally accepted the existence
of 25 subtypes. In Europe it is known the existence of 9 subspecies
A.mellifera, 8 of which lives in South and Central Europe. Only 1
subspecies Apis mellifera mellifera L. (European dark, dark forest, she
Central Russian bee) has mastered steppe and forest zones of Northern
Europe, which makes it very valuable for beekeeping in the Nordic
countries. More hundred years ago, this subspecies is served in the
vast territory of Eurasia along the northern border of the natural
range of the species. The evolution of his flowed in severe climatic
conditions, resulting in a developed an exceptional winter hardiness
and resistance to diseases such as nosema, foulbrood, honeydew
toxicosis. As a result, the mass importation of bees from southern
areas in the forest and steppe zones of Russia, the former area of
the Central Russian bee races were inhabited mostly by bees hybrid
proiskhozhdeniya.K Unfortunately, as a result of continuous import of
bees from the south to the northern regions there was a mass of bees
hybridization. In Germany, a massive import Amcarnica in the 1840s has
led to almost complete replacement of native bees Ammellifera (Maul,
Hahnle, 1994). In the Nordic countries and the British Isles in most of
the well instead of native bees bred Ammellifera Amligustica and
Amcarnica (Cooper 1986; Dews, Milner 1991; Jensen et al., 2005). A
similar situation exists in Russia.
One
of the main conditions for the preservation of the gene pool are
methods of identifying a clear (Daly et al., 1991). Initially it was
used only the analysis of morphometric characters. He laid the
foundation G.A.Kozhevnikov (1900), who made measurements of the
proboscis bees and proposed a method of measuring their chitin parts.
Modern morphometric classification is based on the works of A.mellifera
G.Goetze (1940), V.V.Alpatova (1948) and F.Ruttner et al. (1978).
F.Ruttner (1988, 1992) using multivariate analysis of morphometric
characters developed a method for distinguishing Ammellifera other
European subspecies, but could not find a clear distinction between
morphometric and Amiberica Ammellifera. N.I.Krivtsov (1998) in their
work introduced standards for the size of body parts subspecies
Ammellifera, using which you can quite accurately determine the
subspecies. Also standard morphometry were obtained in our laboratory
for the subspecies Ammellifera Bashkir population (Sattar, Nikolenko,
2002). However, it became known that the morphometric methods often do
not accurately identify the subspecies of the strong dependence of
morphometric characteristics of bees on the environment and the level
of intraspecific hybridization (Guzman-Novoa et al., 1994).
Subsequently,
most of the researchers was the bees to pass on the use of molecular
markers, which give a more accurate, clearly interpretable results
compared with morphometric methods. In our institute developed a method
of rapid PCR-identification of subspecies Ammellifera in
Bashkortostan-based polymorphism intergenic locus COI-COII mtDNA. To
determine the subspecies bee population has been used a method based on
the definition of polymorphism of the intergenic locus COI-COII
mitochondrial DNA, which is characterized by a combination of PQQ
origin of bees from Ammellifera maternal. There were analyzed 69 bee
colonies from 11 apiaries Udmurtia, 144 families from 11 apiaries Perm
region and 406 families 9 apiaries in the Republic of Bashkortostan.
The
results showed that of the apiaries Udmurtia dominated family
originating from Ammellifera. The frequency of bees originating from
Ammellifera was very high in some apiaries Kambarka, Glazov,
Mozhginsky, Udmurtia regions. The Little Purginskom, Sharkan and
Udmurtia regions Zavyalovsky frequency of bees originating from
Ammellifera was quite low, indicating that the importation of bees
southern subspecies. We found high in the apiary bees Ammellifera
originating from the territory of the Republic of Bashkortostan
Tatyshlinskogo district are arguably preserved part of the population
YANAULSKY Ammellifera. Almost the entire territory of Perm Krai was
found many apiaries with most families originating from Ammellifera.
These apiaries are located in Krasnovishersky, Nytvensky, Orda,
Chastinskogo, Perm, Perm Krai Osa region. On the territory of Perm Krai
Uinskogo area of the bee colonies had a hybrid origin. It is possible
that there was some degree of hybridization due to gene flow from the
outside in the apiary. Bees living on the rest of the territory between
the studied local populations, according to our earlier studies
(Nikolenko, Poskryakov, 2002), have been extensively hybridized to
imported from the southern subspecies.
Thus,
we found an apiary with a high frequency of occurrence of bee family,
originating from Ammellifera, allow to speak about the preservation of
local populations in the Urals and Central Russia dark forest bees. The
genetic structure of populations of bees in the Urals and the Volga
region is very complicated, fragmented and discontinuous. There is a
large array of continuous gene pool of bees originating from a dark
forest bees and island population model described in 1969 by C. Wright,
it was very suitable for them. Between local populations is a
continuous gene flow under the impact of anthropogenic and natural
factors intrapopulation. Due to some degree of isolation between the
process of divergence, leading to the accumulation in the bee
population originating from Ammellifera genetic diversity and thus
increases its resistance to environmental factors. To save the bee
population originating from Ammellifera, the Urals and the Volga region
need to preserve the gene pool of each of the local populations we
found clean and a certain isolation from the flow of genes from the bee
populations of hybrid origin. |
044.
Фахретдинова
С.А., Ильясов Р.А., Поскряков А.В., Николенко А.Г. Состояние бурзянской
популяции бортевых пчел Apis mellifera mellifera L. Пчеловодство. № 10.
2008 г. С. 6-7.
Состояние
бурзянской популяции бортевых пчел Apis mellifera mellifera L. (Status
of the Burzyan populations of tree hollow liing bees Apis mellifera
mellifera L.)
Исследования
медоносной пчелы A. m. mellifera Бурзянского района проводила наша
лаборатория. В частности, В.Н.Саттаровым с использованием
молекулярно-генетических методов детально обследовано состояние
генофонда пчел заповедника Шульган-Таш и показано, что популяция
действительно существует.
Население
Бурзянского района, несмотря на развитие пасечного пчеловодства,
сохранило традиционное бортничество. Бортевые пчелы обитают в
естественной среде в суровых условиях и проходят жесткий естественный
отбор. Однако они не могут существовать абсолютно изолированно от
пасек. Их популяция имеет ограниченную численность, поэтому нуждается в
постоянном пополнении за счет пчел окружающих пасек. Таким образом,
между ними идет постоянная миграция, которая помогает ее сохранить.
Подтверждением этого факта может послужить ситуация, сложившаяся в
Южноуральском заповеднике, где с исчезновением деревень полностью
исчезли и бортевые пчелы, хотя сами борти сохранились. В настоящее
время намечается расширение территории заповедника Шульган-Таш, что
поможет сохранить биологическое и ландшафтное разнообразие
широколиственных лесов, а следовательно, и среду обитания бурзянских
пчел (М.Н.Косарев, 2008).
Несмотря
на все меры, угроза гибридизации, а соответственно, и исчезновения этих
уникальных аборигенных пчел все же остается, так как их изучение до сих
пор ограничивалось в основном границами заповедника Шульган-Таш.
Сохранность бортевой пчелы находится в прямой зависимости от всей
популяции Бурзянского района. Поэтому необходимо исследовать пчел всего
района, так как популяция подвержена сильному антропогенному
влиянию и
воздействию условии окружающей среды.
Для
сохранения и восстановления популяции пчел A. m. mellifera Бурзянского
района в границах естественного ареала нами в дальнейшем намечен
следующий объем работ: сбор биологического материала на всей территории
района и прилегающих территорий; определение границ ареала бурзянской
популяции A. m. mellifera; изучение генетических процессов внутри и в
краевых зонах популяции; анализ генетической структуры бурзянской
популяции A. m. mellifera с использованием локу- сов ядерной и
митохондриальной ДНК.
Studies
honeybee A. m. mellifera Burzyansky District conducted in our
laboratory. In particular, V.N.Sattarovym using molecular genetic
methods were examined in detail the status of the gene pool of bees
Reserve Shulgan-Tash and shows that the population does exist.
Population
Burzyansky area, despite the development of bee-bee preserve
traditional beekeeping. Wild-hive bees live in a natural environment in
harsh conditions and are subject to rigorous natural selection.
However, they can not be completely isolated from the apiaries. Their
population has a limited number, so need constant replenishment due to
bees surrounding apiaries. Thus, there is a constant between migration,
which makes it to save. Proof of this fact can serve as a situation in
Yuzhnouralskaya reserve, where the disappearance of villages completely
disappeared and wild-hive bee, although the board survived. At present,
the planned expansion of the reserve Shulgan-Tash, which will help to
conserve biological and landscape diversity of deciduous forests, and
hence the habitat Burzyan bees (M.N.Kosarev, 2008).
Despite
all the measures, the threat of hybridization, and accordingly, and the
disappearance of these unique native bees still remains, since their
study is still limited primarily to the boundaries of the reserve
Shulgan-Tash. Preservation of wild-hive bee is in direct proportion to
the total population Burzyansky area. Therefore it is necessary to
investigate the bees the entire area, as the population is exposed to
strong anthropogenic
influence and
impact of environmental conditions.
To
save and restore populations of bees A. m. mellifera Burzyansky area
within the boundaries of natural habitat in the sequel is planned
following scope of work: the collection of biological material
throughout the area and surrounding areas; delimitation of the area
population Burzyan A. m. mellifera; study of genetic processes within
and in the boundary zones of the population; analysis of the genetic
structure of populations Burzyan A. m. mellifera using loci nuclear and
mitochondrial DNA.
Publication
Name: Fahretdinova S.A., Ilyasov R.A., Poskryakov A.V. Nikolenko A.G.
Status of the Burzyan populations of tree hollow liing bees Apis
mellifera mellifera L. Russian journal of beekeeping. V. 10. 2008 P.
6-7. |
043.
Ильясов
Р.А., Поскряков А.В., Николенко А.Г. Полиморфизм антибактериальных
пептидов в популяции уральских пчел. Материалы международной научной
конференции "Биоразнообразие: проблемы и перспективы сохранения".
Пенза. 2008. Т.2. С. 247-248.
Как
известно, пчелы продуцируют антибактериальные пептиды для защиты от
микроорганизмов. На данный момент у пчел известны антибактериальные
пептиды - абецин, дефензин и гименоптецин, которые, по Б.В.Зюману
(1992), являются необходимыми компонентами групповой и индивидуальной
системы иммунитета пчелиной семьи. C.S.McCleskey, R.M.Melampy (1938) и
H.Yamauchi (2001) продемонстрировали антибактериальные свойства
маточного молочка пчел, секретируемого фарингеальными железами, которое
активно против бактерий и грибков. K.Casteels-Johnson с соавт. (1994)
изучали в гемолимфе у пчел, инфицированных Escherichia coli, четыре
различных типа антимикробных каталитических пептидов –
апидацин,
гименоптецин, абецин и дефензин.
Антибактериальный
пептид дефензин объединяет большое семейство цистеин-богатых
каталитических антимикробных пептидов, воздействующих на разнообразные
микроорганизмы, составляющих основную защитную систему большинства
организмов. Дефензины пчел - пептиды длиной 36-51 аминокислот,
обладающие сходством последовательности, основная структура которых
состоит из концевых аминокислотных повторов, альфа-спирали и двух
антипараллельных цепочек, стабилизированных 3-дисульфидными мостиками
[4]. Дефензин обычно продуцируется последним из всех, но его активность
продолжается свыше двух недель после инфекции [2]. Дефензин гемолимфы и
его предшественник про-пептид были охарактеризованы по кДНК, выделенных
из брюшной полости инфицированных пчел [3].
Другой
дефензин пчел, названный роялизином, был выделен из маточного молочка
пчел и был охарактеризован S.Fujiwara с соавт. (1990) на уровне
пептидов. Оба дефензина пчел содержали 51 аминокислоту. Они отличались
по одной аминокислоте и по группе, состоящей из двух аминокислот при
сравнении последовательностей, представленных в международном GeneBank
(http://www.ncbi.nlm.nih.gov). Пчелиный дефензин, также как шмелиный,
был амилирован и имел дополнительное удлинение на 11 аминокислот с
С-конца, что было несхоже с другими насекомыми. Оказалось, что роялизин
очень активен против грамотрицательных бактерий и неэффективен против
грамположительных. Также была описана антигрибковая активность
пчелиного роялизина [1] и его антибактериальная активность к патогену
Paenibacillus larvae, который является возбудителем болезни личинок
пчел.
А.В.Львов
и А.Г.Николенко (2000) обнаружили существование двух, ранее не
известных, аллельных форм А и В фрагмента гена дефензина. J.Klaudiny с
соавт. (2005) изучили нуклеотидную и аминокислотную последовательности
гена дефензина 1 и показали, что обнаруженный ими антибактериальный
пептид отличался от дефензина, описанного А.В.Львовым и А.Г.Николенко
(2000), заменой T на A в положении 1471, которая приводила к
аминокислотной замене Leu на His; отличался от дефензина, описанного
K.Casteels-Johnson с соавт. (1994) нуклеотидными заменами GGAGT на
TTAGA в положении 1507–1511, которые приводят к
аминокислотной замене
GlyVal на ValGly; отличался от роялизина, описанного S.Fujiwara с
соавт. (1990), нуклеотидными заменами СG на TA в положении
1832–1833,
которые приводят к аминокислотной замене Arg на Tyr. Кроме того, они
показали, что ранее известные дефензин и роялизин были не чем иным, как
полиморфными формами дефензина 1, тогда как обнаруженная ими новая
последовательность гена дефензина 2 лишь на 55,8% сходна с
последовательностью дефензина 1 и являлся геном новой формы дефензина.
Дефензин 1 обладал уникальной среди артропод экзон-интронной
структурой. Оба дефензина экспрессировались в голове и груди. Дефензин
1 обнаружен в гипофаренгиальных, мандибулярных и грудных слюнных
железах пчел, тогда как дефензин 2 отсутствовал. Различная
представленность этих генов отражает тканезависимую экспрессию
дефензина.
Мы
изучили вариабельность фрагмента гена дефензина ядерной ДНК в
популяциях A.m.mellifera на Урале. В исследовании наблюдалось два
аллеля этого локуса. Аллель В фрагмента гена дефензина ядерной ДНК
встречался с частотой 0,14-0,25, а аллель А – с частотой
0,75-0,86. В
работе А.В.Львова и А.Г.Николенко (2002) частота аллелей фрагмента гена
дефензина ядерной ДНК в популяциях пчел на Урале распределялась более
равномерно: аллель B встречался с частотой 0,25-0,45, а аллель A
–
0,55-0,75. Для более детального сравнения можно показать, что работах
А.В.Львова и А.Г.Николенко (2002) в западной и северо-восточной
популяциях пчел на Урале частота встречаемости аллелей B и А фрагмента
гена дефензина ядерной ДНК была 0,25 и 0,75, соответственно, в
янаульской - 0,45 и 0,55, в бурзянской – 0,41 и 0,59, в
иглинской –
0,32 и 0,68. В нашем исследовании в бурзянской и иглинской популяциях
аллель В фрагмента гена дефензина ядерной ДНК встречался с частотой
значительно меньшей таковых в работе А.В.Львова (2002). Различалось
также распределение генотипов фрагмента гена дефензина ядерной ДНК в
популяциях. В нашей работе генотип ВВ фрагмента гена дефензина ядерной
ДНК встречался с частотой 0,06-0,11, генотип АА - 0,61-0,80, генотип АВ
- 0,12-0,29, тогда как в работе А.В.Львова и А.Г.Николенко (2002)
генотип ВВ встречался с частотой 0,00-0,28, генотип АА - 0,35-0,75,
генотип АВ – 0,16-0,48.
Причину
такого распределения аллелей и генотипов фрагмента гена дефензина
ядерной ДНК на данный момент очень сложно однозначно объяснить, но
можно предположить, что популяция пчел на Урале за несколько лет
претерпела некоторые изменения, которые, возможно, связаны с
особенностями организации и развития популяций пчел, как общественных
насекомых, а также с глобальными изменениями экосистем и загрязнением
окружающей среды.
As
is known, bees produce antimicrobial peptides to protect against
microorganisms. At the moment, the bees are known antimicrobial
peptides - abetsin, defensin and gimenoptetsin which in B.V.Zyumanu
(1992), are essential components of group and individual bee colony
immune system. CSMcCleskey, RMMelampy (1938) and H.Yamauchi (2001)
demonstrated the antibacterial properties of royal jelly bee secreted
by pharyngeal glands, which is active against bacteria and fungi.
K.Casteels-Johnson et al. (1994) studied in the hemolymph of bees
infected with Escherichia coli, four different types of antimicrobial
peptides catalyst - apidatsin, gimenoptetsin, abetsin and defensin.
Defensin
antimicrobial peptides brings together a large family of cysteine-rich
catalytic antimicrobial peptides that act on a variety of
micro-organisms that make up the bulk of most organisms defense system.
Defensins bees - 36-51 amino acid long peptides having sequence
similarity, the main structure consisting of repeats terminal amino
acid alpha-helices and two antiparallel chains, stabilized by 3
disulfide bridges [4]. Defensins typically produced last of all, but
its activity continues for more than two weeks after infection [2].
Defensin hemolymph and its precursor pro-peptide have been
characterized by cDNA isolated from abdominal cavity of infected bees
[3].
Another
defensin bees called royalizinom was isolated from royal jelly and bee
was characterized S.Fujiwara et al. (1990) at the level of peptides.
Both defensin bees contained 51 amino acids. They differ by one amino
acid and the group consisting of two amino acids when comparing the
sequences shown in international GeneBank
(http://www.ncbi.nlm.nih.gov). Beeswax defensin, as hornet was
amilirovan and had an elongation of 11 additional amino acids to the
C-terminus that was dissimilar to other insects. It turned out that
royalizin very active against Gram-negative bacteria and is ineffective
against Gram-positive. Also described antifungal activity of bee
royalizina [1] and its antibacterial activity to a pathogen
Paenibacillus larvae, that is larvae bee pathogen.
A.V.Lvov
and A.G.Nikolenko (2000) found the existence of two previously unknown,
allelic forms A and B gene fragment of defensin. J.Klaudiny et al.
(2005) examined the nucleotide and amino acid sequences defensin 1 gene
and showed that they have detected an antibacterial peptide differed
from defensin described A.V.Lvovym and A.G.Nikolenko (2000), by
replacing T with A at position 1471, which resulted in amino acid
substitution of Leu for His; different from the defensin described
K.Casteels-Johnson et al. (1994) at nucleotide substitutions GGAGT
TTAGA at position 1507-1511, which result in an amino acid substitution
at GlyVal ValGly; different from royalizina described S.Fujiwara et al.
(1990), nucleotide substitutions CG to TA at position 1832-1833, which
result in amino acid substitution of Arg for Tyr. In addition, they
showed that the previously known defensin and royalizin were nothing
like polymorphs defensin 1, whereas they discovered a new gene sequence
defensin 2 by only 55.8% similar to the sequence of defensin 1 and was
a new form of defensin gene. Defensin 1 possessed unique among
arthropods exon-intron structure. Both defensin expressed in the head
and chest. 1 defensins found in gipofarengialnyh, mandibular and
thoracic salivary glands of bees, while defensin 2 was absent.
Different representations of these genes reflects tkanezavisimuyu
defensin expression.
We
have studied the variability of defensin gene fragments of nuclear DNA
in populations Ammellifera the Urals. The study observed the two
alleles of this locus. Alleles in the gene fragment of defensin nuclear
DNA occurs with a frequency 0,14-0,25 and allele - with the frequency
of 0,75-0,86. The paper A.V.Lvova and A.G.Nikolenko (2002), the
frequency of allele gene fragment of defensin nuclear DNA in
populations of bees in the Urals are more evenly distributed: B allele
occurs with a frequency 0.25-0.45, and allele A - 0 , 55-0,75. For a
more detailed comparison, we can show that works and A.V.Lvova
A.G.Nikolenko (2002) in the western and north-eastern populations of
bees in the Urals, the frequency of allele B and A gene fragment of
defensin nuclear DNA was 0.25 and 0 , 75, respectively, YANAULSKY -
0.45 and 0.55, in Burzyan - 0.41 and 0.59, in Iglinsky - 0.32 and 0.68.
In our study, in Burzyan and Iglinsky allele in populations defensin
gene fragment nuclear DNA occurs with a frequency significantly lower
than that in the A.V.Lvova (2002). Also differ in the distribution of
genotypes defensin gene fragments of nuclear DNA in populations. In our
work genotype BB defensin gene fragment nuclear DNA met frequency
0,06-0,11 genotype AA - 0,61-0,80 genotype AB - 0,12-0,29, whereas the
AV .Lvova and A.G.Nikolenko (2002) met with BB genotype frequency of
0,00-0,28, genotype AA - 0,35-0,75, genotype AB - 0,16-0,48.
The
reason for this distribution of alleles and genotypes of defensin gene
fragments of nuclear DNA at the moment is very difficult to clearly
explain, but it can be assumed that the population of bees in the
Urals, in a few years has undergone some changes that may be associated
with features of the organization and development of populations of
bees, both public insects, as well as global changes of ecosystems and
environmental pollution. |
042.
Ilyasov
R.A., Poskryakov A.V., Nikolenko A.G. Phylogenetics of honeybees Apis
mellifera mellifera L. from southern and middle Urals. Materials of
international conference "XLV Naukowa konferencja pszczelarska".
Pulawy. 2008. P. 61.
A.m.mellifera
is very important bee subspecies in Western and Northern Eurasia. We
used bees of subspecies A.m.mellifera from Bashkortostan republic and
Perm region of Russia which earlier have been revealed studying
polymorphism of mtDNA intergenic locus COI-COII (Ilyasov et al., 2006).
Three individuals of each population were analyzed. A fragment of 632
bp in mtDNA ND2 was amplified by primers forward 5
'-TGATAAAAGAAATATTTTGA-3 ' and reverse 5 '-GAATCTAATTAATAAAAAA-3 '
(Arias, Sheppard, 1996) and sequenced in 15 bees.
Between
all the bees of Urals populations 5 nucleotide substitutions were
revealed where T>C replacement at position 536 in two bees
DQ181614
and DQ181618 was lead to replacement in peptide aminoacid sequences in
position 12 from Ile to Thr. For phylogenetic analysis we have compared
sequences of mtDNA ND2 gene fragment of Ural bees with other previously
published subspecies A.mellifera and constructed dendrogramm using MEGA
3.1. Sequence of subspecies A.m.anatoliaca has been used as a reference
sequence. All the samples on dendrogramm are grouped into four distinct
clades: A, C, M and O. Name of the clades are given according to
F.Ruttner (1988), M.C.Arias, W.S.Sheppard (1996) and P.Franck et al.
(2001).
Evolutionary
branch M comprises samples of A.m.mellifera from Ural (DQ181611-22) and
Europe: Switzerland (AY114495), France (U35758), Spain (U35759) and
Norway (U35760). However two samples of subspecies A.m.sicula
(AY114493-94) from Sicily and A.m.ligustica (U35752 and AY114490) from
Italy belong to this clade as well what confirms hybridization with
A.m.mellifera.
Thus,
we can to say that between all local populations of A.m.mellifera
haven’t much divergence. Maybe it consequence of historically
recent
divergence, significant migration between populations and absence of
substantial geographical isolations in Europe. |
041.
Ильясов Р.А.,
Поскряков А.В., Николенко А.Г. Мукимов Р.Ш. Пчелы северного
Башкортостана – предварительный генетический анализ.
Материалы
международной научно-практической конференции "Актуальные вопросы
энтомологии". Ставрополь. 2008. С. 253-255.
Республика
Башкортостан расположена на склонах Южного Урала и в основном
расположена в Предуралье. Башкортостан характеризуется многообразием
природных условий и ресурсов, что обусловлено его физико-географическим
положением. Территория Республики, вытянутая с Севера на Юг, входит в
пределы 4 географических зон умеренного пояса: смешанных лесов,
широколиственных лесов, лесостепную, степную. Дикие пчелы являются
неотъемлемым компонентом экосистем уральских горных смешанных липовых
лесов (Петров, 1983).
Пчеловодство
в Башкортостане - древний промысел коренного населения, имеющий
глубокие исторические корни, тысячелетний опыт и традиции. Башкирская
пчела, башкирский мёд с давних времён считались символами
Башкортостана. Для сохранения башкирских пчел был принят Закон
Республики Башкортостан «О пчеловодстве».
Мы
изучали популяции пчел трех северных районов республики –
Балтачевского, Татышлинского и Аскинского и сравнивали с популяцией
пчел Бурзянского района (Николенко, Поскряков, 2002; Ильясов с соавт.,
2007), которая расположена на территории заповедника Шульган-Таш. В
исследовании было использовано 168 семей пчел, собранные в течение
последних трех лет. По результатам предварительных исследований мы
получили структуру распределения генов и генотипов в популяциях. Аллель
1 микросателлитного локуса 4a110 с наибольшей частотой 0,650 встречался
в аскинской популяции, а с наименьшей частотой 0,444 – в
балтачевской.
Аллель 1 для тотальной популяции встречался с средней частотой 0,540, а
аллель 2 – со средней частотой 0,460. Генотипическое
распределение было
следующим. Наибольшее частота гомозигот по аллелю 1 наблюдалась в
аскинской популяции – 0,400, а наименьшая – в
балтачевской – 0,194.
Наибольшая частота гомозигот по аллелю 2 наблюдалась в балтачевской
популяции – 0,306, а наименьшая – в аскинской
– 0,100. Наибольшие
частоты гетерозигот наблюдались в балтачевской и аскинской популяциях
–
0,500, а наименьшая – в бурзянской – 0,387. Средняя
частота гомозигот
по 1 аллелю 0,312, по 2 аллелю – 0,233, гетерозигот
– 0,456.
Наблюдаемое
распределение аллелей в популяции, по расчетам, находится в соответсвии
с равновесным ожидаемым равновесием по Харди-Вайнбергу. Рассчитанные
коэффициенты Fis и Fit указывают на процесс незначительного инбридинга
в этой популяции, а процессы аутбридинга не наблюдаются. Анализ по
локусу COI-COII мтДНК подтвердил принадежность этих пчел к подвиду Apis
mellifera mellifera L. Татышлинская, аскинская и балтачевская популяции
вместе составляют северо-башкирскую популяцию A.m.mellifera.
Таким
образом, по предварительным оценкам, на севере Республики Башкортостан
еще сохранилась популяция A.m.mellifera, обладающая стабильностью
генофонда и изолированная от миграции генов из гибридных популяций.
Механизмы изоляции могут быть совершенно разными, начиная от
антропогенных факторов и заканчивая факторами абиотической среды.
The
Republic of Bashkortostan is located on the slopes of the Southern
Urals and mostly located in the Urals. Bashkortostan is characterized
by the diversity of natural conditions and resources, due to its
physical and geographic location. The territory of the Republic,
extended from north to south, comes within four geographic zones
temperate zones: mixed forests, deciduous forests, forest-steppe,
steppe. Wild bees are an integral component of ecosystems Ural mountain
lime mixed forests (Simpson, 1983).
Beekeeping
in Bashkortostan - the ancient craft of the indigenous population,
which has deep historical roots, a thousand-year experience and
traditions. Bashkir Bee, Bashkir honey since ancient times were
considered symbols of Bashkortostan. To preserve the Bashkir bee was
adopted Law of the Republic of Bashkortostan "On Beekeeping".
We
studied a population of bees the three northern regions of the republic
- Baltachevskogo, Tatyshlinskogo and Askin and compared with the
population of bees Burzyansky area (Nikolenko, Poskryakov, 2002;
Ilyasov et al., 2007), which is located on the reserve Shulgan-Tash.
The study used 168 bee colonies, collected over the past three years.
According to the results of preliminary research we got the structure
of the distribution of genes and genotypes in the population. Allele 1
microsatellite loci 4a110 with the greatest frequency 0.650 Askin met
in a population, and the lowest rate of 0.444 - in baltachevskoy.
Allele 1 for total population met the average frequency 0.540, and
allele 2 - with an average of 0.460. Genotypic distribution was as
follows. The highest frequency of homozygotes for allele 1 was observed
in the population Askin - 0,400, and the lowest - in baltachevskoy -
0.194. The highest frequency of homozygotes for allele 2 was observed
in baltachevskoy population - 0,306, and the lowest - in Askin - 0,100.
The highest frequency of heterozygotes observed in populations
baltachevskoy and Askin - 0,500, and the lowest - in Burzyan - 0.387.
The average frequency of homozygotes for allele 1 0.312, 2 allele -
0.233, heterozygotes - 0.456.
The
observed distribution of alleles in the population, according to
estimates, is in accordance with the equilibrium expected equilibrium
Hardy-Weinberg. Calculate the rate of Fis and Fit indicate a slight
process of inbreeding in this population, and outbreeding processes are
not observed. Analysis locus COI-COII mtDNA confirmed prinadezhnost
these bees to the subspecies Apis mellifera mellifera L.
Tatyshlinskaya, Askin and baltachevskaya populations together make up
the north-Bashkir population Ammellifera.
Thus,
according to preliminary estimates, in the north of the Republic of
Bashkortostan has preserved population Ammellifera, the gene pool is
stable and isolated from the migration of genes from hybrid
populations. The mechanisms of isolation can be quite different,
ranging from human factors and ending with the abiotic environment
factors. |
040.
Ильясов
Р.А., Поскряков А.В., Николенко А.Г. Микроэволюционные процессы в
популяции пчел Apis mellifera mellifera L. (Hymenoptera, Apidae) на
Урале. Материалы международной научно-практической конференции "Живые
объекты в условиях антропогенного пресса". Белгород. 2008. С.79-80.
Естественный
ареал пчел подвида Apis mellifera mellifera L. занимает почти всю
Северную Европу, доходя до Уральских гор [Кривцов, 1982]. В последние
100 лет пчелы этого подвида подверглись интенсивному антропогенному
влиянию и их ареал значительно сократился. Распространение этого
подвида стало прерывистым и один из островков его распространения
находится на Урале.
Поиск
локальных популяций А. т. mellifera проводили методом ПЦР-анализа на
предмет изучения структурного полиморфизма межгенного локуса COI-COII
мтДНК. Ранее было показано, что подвиду А. т. mellifera соответствует
комбинация элементов PQQ, а южным подвидам (A. mellifera ligustica
Spinola, A. mellifera caucasica Gorbatschev и A. mellifera carnica
Pollmann) - только один элемент Q. Результаты анализа показали, что
частота встречаемости комбинации PQQ в уральских популяциях пчел
варьировала от 0.57 до 1.00. Пчелы для исследования были отобраны из
ряда пасек нескольких районов Республики Башкортостан и Пермского края.
Пчелы
с пасек Уинского района Пермского края и Иглинского района Республики
Башкортостан характеризовались частотой встречаемости комбинации PQQ
0.71 и 0.57, соответственно. Такое значение частоты комбинации PQQ в
уинской популяции является показателем ее гибридизации, что
противоречит заключению А. В. Петухова с соавт. [1996], проведенному на
основе данных морфометрического метода.
Наиболее
высокой частотой встречаемости комбинации PQQ характеризовались пасеки
Вишерского района Пермского края - вишерская популяция А. т. mellifera,
пасеки Нытвенского, Пермского, Ординского, Осинского и Частинского
районов Пермского края - южно-прикамская популяция А. т. mellifera,
пасеки и борти Бурзянского района Республики Башкортостан —
бурзянская
популяция А. т. mellifera, а также пасеки Татышлинского района
республики Башкортостан — татышлинская популяция А. т.
mellifera.
На
основе анализа данных о вариабельности фрагмента гена дефензина и
микросателлитных локусов ар243 и 4а110 были рассчитаны генетические
расстояния D по М. Nei [1978] между популяциями пчел на Урале, которые
изменялись в пределах от 0.005 до 0.116. Между популяциями А. m.
mellifera генетические расстояния были в пределах от 0.005 до 0.031,
тогда как между иглинской популяцией и популяциями А. т. mellifera
генетические расстояния имели большие значения и изменялись в пределах
от 0.049 до 0.116. Иглинская популяция оказалась наиболее удалена от
популяций А. т. mellifera, тогда как между популяциями A. m. mellifera
не наблюдалось статистически значимой генетической дифференциации.
Значение
средней наблюдаемой гетерозиготности внутри субпопуляций Но=0354 меньше
значения средней ожидаемой гетерозиготности субпопуляций Д?=0.471 и
средней ожидаемой гетерозиготности всей подразделенной популяции
Я/=0.477, что является показателем дефицита гетерозигот и инбридинга в
локальных популяциях А. т. mellifera на Урале.
Таким
образом, популяции А. т. mellifera на Урале в целом характеризовались
отсутствием статистически значимой генетической дифференциации, а также
небольшим инбридингом и дефицитом гетерозигот. Иглинская же популяция,
как гибридная, характеризовалась значительной генетической
дифференциацией от популяций А. т. mellifera.
The
natural habitat bee subspecies Apis mellifera mellifera L. occupies
almost the entire northern Europe, reaching the Ural Mountains
[Krivtsov, 1982]. In the past 100 years this bee subspecies under
intense anthropogenic impact and their area decreased significantly.
The distribution of this subspecies was intermittent and one of the
islands it is spread in the Urals.
Search
local populations of A. m. Mellifera was performed by PCR analysis for
the study of the structural polymorphism of the intergenic locus
COI-COII mtDNA. Previously, it was shown that the subspecies A. m.
Mellifera appropriate combination of elements PQQ, and the southern
subspecies (A. mellifera ligustica Spinola, A. mellifera caucasica
Gorbatschev and A. mellifera carnica Pollmann) - only one element of Q.
The results showed that the frequency the occurrence of combinations of
PQQ in the Ural populations of bees varied from 0.57 to 1.00. Bees for
the study were selected from a number of apiaries in several areas of
the Republic of Bashkortostan and the Perm region.
Bee
apiaries with Uinskogo district of the Perm Region and the Republic of
Bashkortostan iglinsky district characterized by a combination of
frequency of occurrence PQQ 0.71 and 0.57, respectively. Such frequency
combination in PQQ uinskoy population is an indicator of its
hybridization, which contradicts the conclusion AV Petukhov et al.
[1996] conducted on the basis of morphometric method.
The
highest frequency of occurrence characterized by a combination of PQQ
apiary Vishera district of the Perm region - Visherskaya population of
A. m. Mellifera, apiary Nytvensky, Perm, Orda, Osa and Perm Territory
Chastinskogo areas - South Prikamskaya population of A. m. Mellifera,
apiary and board Burzyansky area Republic of Bashkortostan - Burzyan
population A. m. mellifera, and apiary Tatyshlinskogo district of the
republic of Bashkortostan - tatyshlinskaya population of A. m.
mellifera.
Based
on an analysis of data on the variability of defensin gene fragment and
microsatellite loci and ar243 4a110 were calculated genetic distances D
on M. Nei [1978] between the populations of bees in the Urals, which
ranged from 0.005 to 0.116. Between the populations of A. m. mellifera
genetic distances ranged from 0.005 to 0.031, while between Iglinsky
populations and populations of A. m. mellifera genetic distances were
of great importance and ranged from 0.049 to 0.116. Iglinskiy
population was the most distant from the populations of A. m.
Mellifera, while among populations A. m. mellifera not statistically
significant genetic differentiation.
The
value of the average observed heterozygosity in subpopulations = 0354,
but less than the average expected heterozygosity subpopulations D =
0.471 and the average expected heterozygosity across the subdivided
population I / = 0.477, which is a measure of the deficit of
heterozygotes and inbreeding in the local populations of A. m.
Mellifera in the Urals.
Thus,
the population of A. m. Mellifera in the Urals in general characterized
by a lack of statistically significant genetic differentiation, as well
as a small inbreeding and lack of heterozygotes. Iglinskiy the
population, as a hybrid, characterized by significant genetic
differentiation of populations of A. m. Mellifera. |
039.
Ильясов Р.А.,
Поскряков А.В., Николенко А.Г. Методы идентификации подвида
A.m.mellifera пчелы медоносной. Пчеловодство. № 8. 2008. С. 8-9.
Методы
идентификации подвида A.m.mellifera пчелы медоносной (Identification
methods A.m.mellifera honeybee subspecies)
Существует
ряд методов идентификации подвида A. m. mellifera (темной европейской,
или темной лесной, или среднерусской пчелы). Как можно заметить,что
наиболее перспективный на сегодняшний день — метод
секвенирования
генома, а также методы, основанные на PCR. Наша лаборатория разработала
комплекс методов для идентификации генофонда среднерусской пчелы и
активно ведет работы по поиску сохранившихся популяций A. m. mellifera
на территории всей России и их детальной генетической характеристике.
There
are several methods to identify the subspecies A. m. mellifera (dark
European, or a dark forest, or the Central Russian bees). As you can
see, the most promising to date - the method of genome sequencing, as
well as methods based on PCR. Our laboratory has developed a set of
methods for the identification of the gene pool of the Central Russian
bees and is actively working to find remaining populations of A. m.
mellifera throughout Russia and their detailed genetic characterization.
Publication
Name: Ilyasov R.A., Poskryakov A.V. Nikolenko A.G. Identification
methods A.m.mellifera honeybee subspecies. Russian journal of
beekeeping. V. 8. 2008. P. 8-9. |
038.
Ильясов Р.А.,
Поскряков А.В., Николенко А.Г. Изучение пчел северного Башкортостана.
Вестник Мордовского университета. 2008. № 2. С. 136-137.
Мы
проанализировали популяции пчел некоторых северных районов республики
Башкортостан – Балтачевского, Татышлинского и Аскинского. По
результатам предварительных исследований мы получили представление о
структуре распределения генов и генотипов в популяции.
Мы
изучали популяции пчел трех северных районов республики –
Балтачевского, Татышлинского и Аскинского и сравнивали с популяцией
пчел Бурзянского района, которая расположена на территории заповедника
Шульган-Таш. В исследовании было использовано 168 семей пчел, собранные
в течение последних трех лет.
На
основе анализа полиморфизма межгенного локуса COI-COII митохондриальной
ДНК (мтДНК) была определена подвидовая принадежность семей пчел по
материнской линии (Ильясов с соавт., 2007). Анализ микросателлитного
локуса 4a110 позволил получить представление о структуре распределения
генов и генотипов в популяциях.
Полимеразную
цепную реакцию (ПЦР) проводили в термоциклере
“Циклотерм” при
оптимальной для праймеров температуре отжига. Амплификаты разделяли в
агарозном геле с использованием TBE-буферного раствора и окрашивали
бромистым этидием.
ДНК
выделяли из мышц торакса фиксированных в 96%-ном этаноле пчел.
Выделение проводили смесью гуанидинтиоцианат-фенол-хлороформа
(Chomezynski, Sacchi, 1987).
Аллель
1 микросателлитного локуса 4a110 с наибольшей частотой 0,650 встречался
в аскинской популяции, а с наименьшей частотой 0,444 – в
балтачевской.
Аллель 1 для тотальной популяции встречался с средней частотой 0,540, а
аллель 2 – со средней частотой 0,460. Генотипическое
распределение было
следующим. Наибольшее частота гомозигот по аллелю 1 наблюдалась в
аскинской популяции – 0,400, а наименьшая – в
балтачевской – 0,194.
Наибольшее частота гомозигот по аллелю 2 наблюдалась в балтачевской
популяции – 0,306, а наименьшая – в аскинской
– 0,100. Наибольшие
частоты гетерозигот наблюдались в балтачевской и аскинской популяциях
–
0,500, а наименьшая – в бурзянской – 0,387. Средняя
частота гомозигот
по 1аллелю 0,312, по 2 аллелю – 0,233, гетерозигот
– 0,456.
Наблюдаемое
распределение аллелей в популяции, по расчетам, находится в соответсвии
с равновесным ожидаемым равновесием по Харди-Вайнбергу. Рассчитанные
коэффициенты Fis и Fit указывают на процесс незначительного инбридинга
в этой популяции, а процессы аутбридинга не наблюдаются. Анализ по
локусу COI-COII мтДНК подтвердил принадежность этих пчел к подвиду
A.m.mellifera. Татышлинская, аскинская и балтачевская популяции вместе
составляют северо-башкирскую популяцию A.m.mellifera.
Таким
образом, по предварительным оценкам, на севере Республики Башкортостан
еще сохранилась популяция A.m.mellifera, обладающая стабильностью
генофонда и изолированная от миграции генов из гибридных популяций.
Механизмы изоляции могут быть совершенно разными, начиная от
антропогенных факторов и заканчивая факторами абиотической среды.
We
have analyzed the bee population of some northern areas of the Republic
of Bashkortostan - Baltachevskogo, Tatyshlinskogo and Askin. According
to the results of preliminary research we got an idea of the
structure of the distribution of genes and genotypes in the population.
We
studied a population of bees the three northern regions of the republic
- Baltachevskogo, Tatyshlinskogo and Askin and compared with the
population of bees Burzyansky area, which is located on the reserve
Shulgan-Tash. The study used 168 bee colonies, collected over the past
three years.
Based
on the analysis of polymorphism of the intergenic locus COI-COII
mitochondrial DNA (mtDNA) has been defined subspecies prinadezhnost bee
families on the maternal line (Ilyasov et al., 2007). Analysis of
microsatellite loci 4a110 allowed to get an idea about the structure of
the distribution of genes and genotypes in the population.
Polymerase
chain reaction (PCR) was performed in a thermal cycler "Tsikloterm" at
the optimum annealing temperature for the primers. Amplificate were
separated by agarose gel electrophoresis using TBE-buffer and stained
with ethidium bromide.
DNA
was isolated from the thorax muscles fixed in 96% ethanol bees.
Isolation was carried out with a mixture of guanidine
thiocyanate-phenol-chloroform (Chomezynski, Sacchi, 1987).
Allele
1 microsatellite loci 4a110 with the greatest frequency 0.650 Askin met
in a population, and the lowest rate of 0.444 - in baltachevskoy.
Allele 1 for total population met the average frequency 0.540, and
allele 2 - with an average of 0.460. Genotypic distribution was as
follows. The highest frequency of homozygotes for allele 1 was observed
in the population Askin - 0,400, and the lowest - in baltachevskoy -
0.194. The highest frequency of homozygotes for allele 2 was observed
in baltachevskoy population - 0,306, and the lowest - in Askin - 0,100.
The highest frequency of heterozygotes observed in populations
baltachevskoy and Askin - 0,500, and the lowest - in Burzyan - 0.387.
The average frequency of homozygotes for 1allelyu 0.312, 2 allele -
0.233, heterozygotes - 0.456.
The
observed distribution of alleles in the population, according to
estimates, is in accordance with the equilibrium expected equilibrium
Hardy-Weinberg. Calculate the rate of Fis and Fit indicate a slight
process of inbreeding in this population, and outbreeding processes are
not observed. Analysis locus COI-COII mtDNA confirmed prinadezhnost
these bees to the subspecies Ammellifera. Tatyshlinskaya, Askin and
baltachevskaya populations together make up the north-Bashkir
population Ammellifera.
Thus,
according to preliminary estimates, in the north of the Republic of
Bashkortostan has preserved population Ammellifera, the gene pool is
stable and isolated from the migration of genes from hybrid
populations. The mechanisms of isolation can be quite different,
ranging from human factors and ending with the abiotic environment
factors. |
037.
Шамсиева Э.Т.,
Ильясов Р.А. Исследование пчел в Республике Башкортостан. Материалы
международной научно-практической конференции "Биология: теория,
практика, эксперимент". Саранск. 2008. С. 197-198.
Медоносная
пчела Apis mellifera L. по современной классификации ПоДразделяется на
25 подвидов[2]. Подвид Apis mellifera mellifera L. занимал территорию
вдоль северной границы естественного видового ареала, подвид оптимально
приспособлен к жизни в Северной Европе и Азии
В
последнее время произошла гибридизация пчел в Европе и России в
результате чего практически невозможно было найти сохранившиеся
популяции A.rn.mellifera. Однако имеются сведения о том, что в
отдельных местах еще могли сохраниться популяции A.rn.mellifera [1].
Морфометрические
методы не позволяют достоверно определять подвиды пчел в случае
гибридизации, тогда как молекулярные методы оказались более пригодными.
Мы
в лаборатории биохимии адаптивности насекомых Института биохимии и
генетики УНЦ РАН исследовали популяции пчел северных районов Республики
Башкортостан и обнаружили высокое содержание подвида A.rn.mellifera.
Идентификацию подвида проводили на основе изучения локусов ядерной и
митохондриальной ДНК. В результате проведенных исследований мы
планируем найти другие сохранившиеся популяции A.rn.mellifera и
определить их генетическую структуру.
A
honey bee Apis mellifera L. in modern classification is subdivided into
25 sub-species [2]. The subspecies Apis mellifera mellifera L. occupied
territory along the northern border of the natural habitat of the
species, subspecies optimally adapted to life in Northern Europe and
Asia
Recently,
there was a hybridization of bees in Europe and Russia as a result it
was almost impossible to find a surviving population A.rn.mellifera.
However, there is evidence that in some places could still keep the
population A.rn.mellifera [1].
Morphometric
methods do not reliably determine the subspecies of bees in the case of
hybridization, whereas molecular methods were more suitable.
We
are in the biochemistry laboratory of adaptability insects Institute of
Biochemistry and Genetics, Ufa Science explored the bee population of
the northern regions of the Republic of Bashkortostan and found high
levels of subspecies A.rn.mellifera. The identification of the
subspecies was performed by examining the loci of nuclear and
mitochondrial DNA. As a result of the research we plan to find other
extant populations A.rn.mellifera and determine their genetic structure. |
036.
Ильясов
Р.А., Поскряков А.В., Филатов В.С., Николенко А.Г. Характеристика
популяции пчел юго-запада Свердловской области. Пчеловодство. № 5.
2008. С. 18.
Характеристика
популяции пчел юго-запада Свердловской области (Characteristics of the
bee population southwest of the Sverdlovsk region)
Популяция
пчел юго-запада Свердловской области, в частности Красноуфимского
района, разнородна. В среднем по району только около 30% пчел имеют
происхождение от подвида А. т. mellifera. Результаты этих исследований
показывают, что восточная граница ареала популяции А. т. mellifera
проходит по хребтам Уральских гор: в Зауралье обитают только гибридные
пчелы, а в Предуралье еще сохранилась популяция аборигенных пчел А. т.
mellifera, не ставшая жертвой массовой гибридизации (Ильясов с соавт.,
2005, 2006).
Bee
population southwest of the Sverdlovsk region, in particular
Krasnoufimsky area is heterogeneous. On average, the district is only
about 30% of the bees are derived from the subspecies A. m. Mellifera.
The results of these studies show that the eastern boundary of the
range of the population of A. m. Mellifera runs along the ridges of the
Ural Mountains: in the Urals found only hybrid bees, and in the Urals
still remaining populations of native bees A. m. Mellifera, do not
become a victim of mass hybridization.
Publication
Name: Ilyasov R.A., Poskryakov A.V., Filatov VS Nikolenko A.G.
Characteristics of the bee population southwest of the Sverdlovsk
region. Russian journal of beekeeping. V. 5. 2008. P. 18-19. |
035.
Ильясов Р.А. ,
Поскряков А.В., Колбина Л.М., Николенко А.Г. Характеристика пчел
республики Удмуртия. Материалы международной научной конференции
"Проблемы биоэкологии и пути их решения". Саранск. 2008. С. 142-144.
ХАРАКТЕРИСТИКА
ПЧЕЛ РЕСПУБЛИКИ УДМУРТИЯ
Медоносная
пчела Apis mellifera L. - уникальный объект сельского хозяйства. Помимо
большого хозяйственного значения пчела является также интересным
объектом научных исследований как представитель общественных насекомых.
Медоносная пчела подвида Apis mellifera mellifera L. – пчела
среднерусской расы в России наиболее из всех других подвидов
приспособлена к жизни в условиях резко-континентального климата
Евразии, что ставит задачу сохранения генофонда A.m.mellifera на первый
план.
Для
определения подвидового состава медоносных пчел морфометрическим
методом было обследовано 515 пчелиных семей южных и центральных районов
Республики Удмуртия (табл. 1). Из морфологических методов в наибольшем
объеме использовались такие морфометрические признаки, как длина
хоботка, кубитальный и тарзальный индексы, ширина третьего тергита,
дискоидальное смещение.
Морфометрические
исследования показали, что только 10% семей пчел принадлежат подвиду
A.m.mellifera. Первый и основной шаг в восстановлении популяций
A.m.mellifera в Удмуртской Республике – поиск сохранившихся
популяций с
использованием наиболее эффективных методов идентификации подвидов.
Для
определения подвидовой принадлежности пчел с помощью
молекулярно-генетических методов был использован полиморфизм межгенного
локуса COI-COII митохондриальной ДНК (мтДНК), комбинация PQQ которого
характеризует происхождение пчел от A.m.mellifera по материнской линии.
Молекулярно-генетическим методом было проанализировано 69 семей пчел с
11 пасек 6 районов республики Удмуртия.
Результаты
молекулярно-генетических исследований показали, что на большинстве
пасек преобладали семьи имеющие происхождение от A.m.mellifera. Частота
комбинации PQQ была высокой (>0,95) на некоторых пасеках
Можгинского
и Завьяловского районов, а в большинстве других районах наблюдалась
довольно низкая частота комбинации PQQ (<0.70), что
свидетельствует
о завозе пчел южных подвидов (табл. 2).
Результаты
молекулярно-генетического и морфологического методов более чем на 66%
совпали в Можгинском районе, а в Шарканском оказались диаметрально
противоположены. Это позволяет утверждать о том, что популяция пчел
Можгинского района действительно относится к подвиду A.m.mellifera,
тогда как во всех остальных районах пчелы возможно гибридизованы с
пчелами южных подвидов.
Таким
образом, проведенные исследования показали также, что ни один из
использованных методов не стоит абсолютизировать. Поскольку
аборигенными пчелами для всего Поволжья, в том числе и Удмуртской
Республике были среднерусские пчелы, то есть пчелы подвида Apis
mellifera mellifera L, а завезенные семьи южных подвидов составляли
небольшой процент от общего количества разводимых пчел, это привело к
тому, что большая часть местных пчел имеет гибридизацию по мужской
линии, которую использованный молекулярно-генетический метод, к
сожалению, определить не может. С другой стороны большая вариабельность
морфологических признаков появившаяся в результате гибридизации привела
к тому, что часть помесных пчел может по экстерьеру соответствовать
A.m.mellifera, не являясь таковой на самом деле. Поэтому достоверные
результаты могут быть получены только при использовании как
морфологических, так и молекулярно-генетических методов исследования,
охватывающих не только митохондриальный, но и ядерный геномы.
A
honey bee Apis mellifera L. - a unique facility agriculture. In
addition to the great economic importance of the bee it is also an
interesting subject of research as a representative of the social
insects. Honeybee subspecies Apis mellifera mellifera L. - Central
Russian bee races in Russia most of all the other subspecies adapted to
life in conditions of sharply continental climate of Eurasia, which
makes the task of preserving the gene pool Ammellifera to the fore.
To
determine the composition of the honey bee subspecies morphometric
method was examined 515 bee colonies of the southern and central
regions of the Republic of Udmurtia (Table. 1). From morphological
methods were used in the greatest amount of morphometric features such
as the proboscis, tarsal and cubital index, the width of the third
tergite, discoid offset.
The
morphometric studies showed that only 10% of bee colonies belong to the
subspecies Ammellifera. The first and basic step in restoring
populations Ammellifera in the Udmurt Republic - find remaining
populations using the most effective methods of identifying subspecies.
To
determine the subspecies of bees using molecular genetic techniques was
used polymorphism of the intergenic locus COI-COII mitochondrial DNA
(mtDNA), which is characterized by a combination of PQQ origin of bees
from Ammellifera maternal. Molecular genetic methods have been analyzed
69 bee colonies from 11 apiaries 6 regions of the republic of Udmurtia.
The
results of the molecular genetic studies have shown that in most
apiaries dominated family originating from Ammellifera. Frequency
combination PQQ was high (> 0.95) in some apiaries Mozhginsky
and
Zavyalovsky areas, and in most other areas, there is quite a low
frequency combination PQQ (<0.70), indicating that the
importation
of bees southern subspecies (Table. 2).
The
results of molecular genetic and morphological methods for more than
66% in matched Mozhginsky area and Sharkan appeared diametrically
opposed. This suggests that the population of bees Mozhginsky area
really belongs to the subspecies Ammellifera, whereas in all other
regions of the bees might hybridize with the southern subspecies of
bees.
Thus,
the studies also showed that none of the methods used is not absolute.
Since the native bees for the whole Volga region, including the
Republic of Udmurtia were Central Russian bees, ie bee subspecies Apis
mellifera mellifera L, and the family of the southern subspecies
imported accounted for a small percentage of the total farmed bees,
this has led to the fact that most of the local bees a hybridization of
the male line, which used molecular genetic techniques, unfortunately,
can not be determined. On the other hand a large morphological
variability of signs appear as a result of hybridization has led to the
fact that part of the hybrid bees can fit on the exterior Ammellifera,
not being such in reality. Therefore, accurate results can be obtained
only by using both morphological and molecular genetic research
methods, covering not only the mitochondrial, and nuclear genomes.
CHARACTERISTICS
OF BEES FROM UDMURTIYA REPUBLIC
Summary.
Our research was made on morphometric and genetics methods. For
analysis we used bees from 584 colonies in Udmurtiya Republic.
Morphometric analysis consist in measuring of tongue, cubital and
tarsal index, third tergit width and discoidal shift. Genetics methods
include analysis of intergenic locus COI-COII of mtDNA. We found little
inconsistency between morphometric and genetics data. Probably bees in
some regions of Udmurtiya had hybrid origin. |
034.
Ильясов Р.А.,
Поскряков А.В., Филатов В.С., Николенко А.Г. Генофонд пчел
Красноуфимского района Свердловской области. Материалы II Всероссийской
научно-практической конференции "Экологические системы: фундаментальные
и прикладные исследования". Нижний Тагил. 2008. Т. 1. С. 167-170
Генофонд
пчел Красноуфимского района Свердловской области
Естественный
ареал пчел подвида Apis mellifera mellifera L. распространяется от
Великобритании вдоль всей Северной Европы до Уральских гор. Уральские
горы оказались преградой для распространения пчел на восток в Азию,
однако, благодаря вмешательству человека, пчелы получили возможность
распространиться в Сибирь до Дальнего Востока. Широкому расселению пчел
способствовали идеальные для подвида A.m.mellifera L. природные и
климатические условия – территории, занятые лесами и
лесостепями с
обильной медоносной растительностью в условиях континентального
климата. В России наиболее известны такие регионы пчеловодства, как
Алтай, Поволжье, Южный и Средний Урал. На Урале наиболее славятся
пчеловодством Республика Башкортостан, Пермский край и Свердловская
область, а в Поволжье - Республика Татарстан и Удмуртия (Кривцов, 1995).
В
Свердловской области на сегодняшний день насчитывается около 46 тысяч
пчелиных семей, которые принадлежат в основном частным хозяйствам.
Крупных пчеловодческих хозяйств в области нет. Пчеловодство значительно
развито на юго-западе Свердловской области - в Красноуфимском, Ачитском
и Артинском районах, которые имеют сходные рельефные, ландшафтные и
экологические условия (Филатов, 2004). Как известно, пчелы очень
чувствительны к загрязнению окружающей среды, поэтому в местах с
неблагополучной экологией, таких как окрестности городов Асбест,
Краснотурьинск, Первоуральск, пчеловодство довольно плохо развито, так
как регулярно происходит массовая гибель пчел.
Известно,
что ранее на юго-западе Свердловской области содержали пчел подвида
A.m.mellifera, которые были завезены из Предуралья через Пермь и Кунгур
и с юга из Башкортостана с переселенцами. Эти пчелы отличались
устойчивостью к продолжительным холодным зимам, многим болезням пчел и
идеальной приспособленностью к жизни в местных условиях (Филатов, 2004).
Для
успешного решения сельскохозяйственных задач в этом регионе с 1940-х по
1960-е годы были массово завезены южные подвиды пчел с Кавказа. С
1970-х по 1990-е годы были завезены карпатские пчелы из Мукачевского
пчелопитомника. В 1990-х годах туда также были завезены пчелы Кубани и
из Узбекистана (Филатов, 2004). Таким образом, на сегодняшний момент
большинство семей пчел на юго-западе Свердловской области оказались
гибридизованными с южными подвидами, в результате чего были потеряны
многие ценные качества местных среднерусских пчел подвида A.m.mellifera.
Нами
были проанализированы рабочие пчелы из 50 семей 8 частных пасек
Красноуфимского района Свердловской области (рис. 1), собранные в
течение лета 2006 года. Для идентификации происхождения пчел по
материнской линии мы использовали полиморфный локус COI-COII мтДНК
(Никоноров с соавт., 1998), который у подвида A.m.mellifera имеет
размер около 600 п.н. (комбинация PQQ), а у южных подвидов –
A.m.caucasica, A.m.carnica, A.m.ligustica – около 350 п.н.
(комбинация
Q).
В
результате анализа для каждой пасеки были рассчитаны частоты
встречаемости семей пчел, имеющих происхождение от A.m.mellifera и
содержащих комбинацию PQQ (табл. 1). Как оказалось, частота комбинации
PQQ была для всего района в общем очень низкой, что еще раз
подтверждает массовый завоз пчел из южных регионов. На пасеках
Ю.М.Попова в д. Савиново, Г.А.Ватолина в д. Татарский Турыш и
В.Ф.Васильева в д. Верхняя Ирга вообще не оказалось семей пчел, имеющих
происхождение от среднерусских. Наоборот, все пчелиные семьи на пасеке
Е.В.Чухарева в д. Татарский Турыш характеризовались происхождением от
A.m.mellifera. Все остальные пасеки содержали от 13 до 60% семей пчел
происходящих от среднерусских пчел подвида A.m.mellifera.
Таким
образом, популяция пчел юго-запада Свердловской области, в частности,
Красноуфимского района, является интенсивно гибридизованной с
подвидами, завезенными из южных регионов России и ближнего зарубежья. В
среднем по району только около 30% пчел имеют происхождение от подвида
A.m.mellifera. По результатам этих исследований можно определить
западную границу ареала популяции A.m.mellifera, которая проходит по
хребтам Уральских гор, где в Зауралье обитают только гибридные пчелы, а
в Предуралье еще сохранилась популяция аборигенных A.m.mellifera не
подверженная массовой гибридизации (Ильясов с соавт., 2005, 2006).
The gene pool of
bees Krasnoufimsky district of Sverdlovsk region
The
natural habitat bee subspecies Apis mellifera mellifera L. extends
along the whole of the UK in Northern Europe to the Ural Mountains.
Ural Mountains proved a barrier to the spread of bees East Asia,
however, thanks to the intervention of man, bees were able to spread to
Siberia and the Far East. The wide dispersal of bees contributed ideal
for Ammellifera L. subspecies natural and climatic conditions -
territory occupied by forests and forest honey with abundant vegetation
in a continental climate. In Russia, the most well-known regions such
beekeeping as Altai, Volga, Southern and Middle Urals. In the Urals,
the most famous beekeeping Republic of Bashkortostan, Perm and
Sverdlovsk region and the Volga - Tatarstan and Udmurtia (Krivtsov,
1995).
In
the Sverdlovsk region today, there are about 46 thousand bee families,
who belong mostly to private farms. Large bee farms in the area do not.
Beekeeping is a significant development in the southwest of the
Sverdlovsk region - Krasnoufimsk, Achitskom and Artinsky areas that
have similar relief, landscape and environmental conditions (Filatov,
2004). It is known that bees are very sensitive to pollution, so in
areas with unfavorable environment, such as the surroundings of
Asbestos, Krasnoturinsk, Pervouralsk, beekeeping rather poorly
developed, as regularly occurs mass death of bees.
It
is known that earlier in the southwest of the Sverdlovsk region
contained bee subspecies Ammellifera, which were imported from across
the Urals Perm and Kungur and south of Bashkortostan with the settlers.
These bees are resistant to long cold winters, many diseases of bees
and ideally suited to life in the local context (Filatov, 2004).
To
successfully solve agricultural problems in the region from the 1940s
to 1960's were massively brought the southern subspecies of bees from
the Caucasus. From the 1970s to the 1990s were brought to the
Carpathian bees from Mukachevo pchelopitomnika. In the 1990s there were
also imported bees Kuban and Uzbekistan (Filatov, 2004). Thus, at the
moment most of the bee colonies in the southwest of the Sverdlovsk
region appeared hybridized with the southern subspecies, which resulted
in losing a lot of valuable qualities of the local Central Russian bee
subspecies Ammellifera.
We
have analyzed the worker bees of the 50 families of 8 private apiaries
Krasnoufimsky district of Sverdlovsk region (Fig. 1), collected during
the summer of 2006. To identify the origin of bees through the maternal
line, we used polymorphic locus COI-COII mtDNA (Nikonorov et al.,
1998), which have Ammellifera subspecies has a size of about 600 bp (A
combination of PQQ), and the southern subspecies - Amcaucasica,
Amcarnica, Amligustica - about 350 bp (Combination of Q).
The
analysis for each apiary were calculated incidence of bee colonies,
originating from Ammellifera and containing a combination of PQQ
(Table. 1). As it turned out, the combination of the frequency of PQQ
has been for the entire region in general is very low, which again
confirms the massive importation of bees from southern regions. On
apiaries Yu.M.Popova in the village. Savinovo, G.A.Vatolina in the
village. Turishev Tatar and V.F.Vasileva in the village. The top was
not at all Saskatoon bee colonies, originating from Central Russia. On
the contrary, all bee colonies in the apiary in the village
E.V.Chuhareva. Turishev Tatar origin characterized by Ammellifera. All
other apiary contain 13 to 60% of bee colonies originating from the
Central Russian bee subspecies Ammellifera.
Thus,
the population of bees southwest of the Sverdlovsk region, in
particular, Krasnoufimsky area is extensively hybridized with the
subspecies imported from the southern regions of Russia and neighboring
countries. On average, the district only about 30% of bees have
descended from the subspecies Ammellifera. The results of these studies
can determine the western border area populations Ammellifera, which
runs along the ridges of the Ural Mountains, which are found only in
the Urals hybrid bees, and in the Urals region still keep the
population of native Ammellifera not subject to mass hybridization
(Ilyasov et al., 2005, 2006 ). |
033.
Ильясов
Р.А., Поскряков А.В., Николенко А.Г. Генетическая структура популяций
пчел Урала и Поволжья. Материалы международной научно-практической
конференции "Проблемы биологии, экологии, географии, образования:
история и современность". Санкт-Петербург-Пушкин. 2008. С.76-78.
Ещё
двести лет назад подвид Apis mellifera mellifera L занимал в Евразии
огромную территорию вдоль северной границы естественного ареала вида.
Эволюция его протекала в суровых климатических условиях, в результате
чего выработалась исключительная зимостойкость и устойчивость к таким
заболеваниям, как нозематоз, гнилец, падевый токсикоз. В результате
массового завоза пчел из южных районов в лесную и лесостепную зоны
России, прежний ареал пчелы среднерусской расы оказался заселен в
основном пчёлами гибридного происхождения. К сожалению, в результате
непрерывного импорта пчел с юга в северные регионы произошла массовая
гибридизация пчёл.
Одним
из основных условий сохранения генофонда являются методы его чёткой
идентификации (Daly et al., 1991). Первоначально для этого
использовался только анализ морфометрических признаков. Его основу
заложил Г.А.Кожевников (1900), который сделал промеры длины хоботка
пчел и предложил методику измерения их хитиновых частей. Современная
морфометрическая классификация A.mellifera основывается на работах
G.Goetze (1940), В.В.Алпатова (1948) и F.Ruttner et al. (1978).
F.Ruttner (1988, 1992) с использованием мультивариантного анализа
морфометрических признаков разработал метод отличения A.m.mellifera от
других европейских подвидов, однако не смог найти четких
морфометрических различий между A.m.iberica и A.m.mellifera.
Н.И.Кривцов (1998) в своей работе представил стандарты размеров частей
тела для подвида A.m.mellifera, используя которые можно довольно точно
определить подвидовую принадлежность. Также стандарты морфометрии были
получены в нашей лаборатории для подвида A.m.mellifera башкирской
популяции (Саттаров, Николенко, 2002). Однако стало известно, что
морфометрические методы часто не позволяют точно идентифицировать
подвиды из-за сильной зависимости морфометрических характеристик пчел
от условий окружающей среды и уровня внутривидовой гибридизации
(Guzman-Novoa et al., 1994).
Впоследствии
большинство исследователей пчел стало переходить на использование
молекулярных маркеров, дающих более точные, однозначно интерпретируемые
результаты по сравнению с морфометрическими методами. В нашем институте
разработана методика быстрой PCR-идентификации подвида A.m.mellifera в
Республике Башкортостан на основе полиморфизма межгенного локуса
COI-COII мтДНК. Для определения подвидовой принадлежности популяции
пчел был использован метод на основе определения полиморфизма
межгенного локуса COI-COII митохондриальной ДНК, комбинация PQQ
которого характеризует происхождение пчел от A.m.mellifera по
материнской линии. Всего было проанализировано 69 семей пчел с 11 пасек
Удмуртии, 144 семей с 11 пасек Пермского края и 406 семей 9 пасек
Республики Башкортостан.
Результаты
показали, что на части пасек Удмуртии преобладали семьи имеющие
происхождение от A.m.mellifera. Частота пчел происходящих от
A.m.mellifera была очень высокой на некоторых пасеках Камбарского,
Глазовского, Можгинского, районов Удмуртии. В Мало-Пургинском,
Шарканском и Завьяловском районах Удмуртии частота пчел происходящих от
A.m.mellifera оказалась довольно низкой, что свидетельствует о завозе
пчел южных подвидов. Найденные нами пасеки с высоким содержанием пчел
происходящих от A.m.mellifera на территории Татышлинского района
республики Башкортостан, возможно, являются сохранившейся частью
янаульской популяции A.m.mellifera. Практически на всей территории
Пермского края было обнаружено множество пасек с большинством семей,
происходящих от A.m.mellifera. Эти пасеки расположены на территории
Красновишерского, Нытвенского, Ординского, Частинского, Пермского,
Осинского районов Пермского края. На территории Уинского района
пермского края часть семей пчел имело гибридное происхождение.
Возможно, что произошла некоторая степень гибридизации благодаря потоку
генов извне в эти пасеки. Пчелы, обитающие на всей остальной
территории, между изученными нами локальными популяциями, по ранним
нашим исследованиям (Николенко, Поскряков, 2002), были интенсивно
гибридизованы с завозными южными подвидами.
Таким
образом, обнаруженные нами пасеки с высокой частотой встречаемости
семьей пчел, имеющих происхождение от A.m.mellifera, позволяют говорить
о сохранении на Урале локальных популяций темной лесной или
среднерусской пчелы. Генетическая структура популяций пчел на Урале и
Поволжье очень сложная, прерывистая и фрагментированная. Нет большого
непрерывного массива генофонда пчел, происходящих от темной лесной
пчелы, а островная модель популяции, описанная в 1969 году С. Райтом,
оказалась для них очень подходящей. Между локальными популяциями
происходит непрерывный поток генов как под воздействием антропогенных,
так и естественных внутрипопуляционных факторов. Благодаря некоторой
степени изоляции между ними происходит процесс дивергенции, что
приводит к накоплению в популяции пчел происходящих от A.m.mellifera
генетического разнообразия и тем самым повышает его устойчивость к
факторам окружающей среды. Для сохранения популяции пчел, происходящих
от A.m.mellifera, на Урале и Поволжье необходимо сохранить генофонд
каждой из обнаруженных нами локальных популяций в чистоте и
определенной изоляции от потока генов из популяций пчел гибридного
происхождения.
More
hundred years ago, a subspecies of Apis mellifera mellifera L held in
the vast territory of Eurasia along the northern border of the natural
range of the species. The evolution of his flowed in severe climatic
conditions, resulting in a developed an exceptional winter hardiness
and resistance to diseases such as nosema, foulbrood, honeydew
toxicosis. As a result, the mass importation of bees from southern
areas in the forest and steppe zones of Russia, the former area of
the Central Russian bee races were inhabited mostly by bees hybrid
origin. Unfortunately, as a result of continuous import of bees from
the south to the northern regions there was a mass of bees
hybridization.
One
of the main conditions for the preservation of the gene pool are
methods of identifying a clear (Daly et al., 1991). Initially it was
used only the analysis of morphometric characters. He laid the
foundation G.A.Kozhevnikov (1900), who made measurements of the
proboscis bees and proposed a method of measuring their chitin parts.
Modern morphometric classification is based on the works of A.mellifera
G.Goetze (1940), V.V.Alpatova (1948) and F.Ruttner et al. (1978).
F.Ruttner (1988, 1992) using multivariate analysis of morphometric
characters developed a method for distinguishing Ammellifera other
European subspecies, but could not find a clear distinction between
morphometric and Amiberica Ammellifera. N.I.Krivtsov (1998) in their
work introduced standards for the size of body parts subspecies
Ammellifera, using which you can quite accurately determine the
subspecies. Also standard morphometry were obtained in our laboratory
for the subspecies Ammellifera Bashkir population (Sattar, Nikolenko,
2002). However, it became known that the morphometric methods often do
not accurately identify the subspecies of the strong dependence of
morphometric characteristics of bees on the environment and the level
of intraspecific hybridization (Guzman-Novoa et al., 1994).
Subsequently,
most of the researchers was the bees to pass on the use of molecular
markers, which give a more accurate, clearly interpretable results
compared with morphometric methods. In our institute developed a method
of rapid PCR-identification of subspecies Ammellifera in
Bashkortostan-based polymorphism intergenic locus COI-COII mtDNA. To
determine the subspecies bee population has been used a method based on
the definition of polymorphism of the intergenic locus COI-COII
mitochondrial DNA, which is characterized by a combination of PQQ
origin of bees from Ammellifera maternal. There were analyzed 69 bee
colonies from 11 apiaries Udmurtia, 144 families from 11 apiaries Perm
region and 406 families 9 apiaries in the Republic of Bashkortostan.
The
results showed that of the apiaries Udmurtia dominated family
originating from Ammellifera. The frequency of bees originating from
Ammellifera was very high in some apiaries Kambarka, Glazov,
Mozhginsky, Udmurtia regions. The Little Purginskom, Sharkan and
Udmurtia regions Zavyalovsky frequency of bees originating from
Ammellifera was quite low, indicating that the importation of bees
southern subspecies. We found high in the apiary bees Ammellifera
originating from the territory of the Republic of Bashkortostan
Tatyshlinskogo district are arguably preserved part of the population
YANAULSKY Ammellifera. Almost the entire territory of Perm Krai was
found many apiaries with most families originating from Ammellifera.
These apiaries are located in Krasnovishersky, Nytvensky, Orda,
Chastinskogo, Perm, Perm Krai Osa region. On the territory of Perm Krai
Uinskogo area of the bee colonies had a hybrid origin. It is possible
that there was some degree of hybridization due to gene flow from the
outside in the apiary. Bees living on the rest of the territory between
the studied local populations, according to our earlier studies
(Nikolenko, Poskryakov, 2002), have been extensively hybridized to
imported from the southern subspecies.
Thus,
we found an apiary with a high frequency of occurrence of bee family,
originating from Ammellifera, allow to speak about the preservation of
local populations in the Urals and Central Russia dark forest bees. The
genetic structure of populations of bees in the Urals and the Volga
region is very complicated, fragmented and discontinuous. There is a
large array of continuous gene pool of bees originating from a dark
forest bees and island population model described in 1969 by C. Wright,
it was very suitable for them. Between local populations is a
continuous gene flow under the impact of anthropogenic and natural
factors intrapopulation. Due to some degree of isolation between the
process of divergence, leading to the accumulation in the bee
population originating from Ammellifera genetic diversity and thus
increases its resistance to environmental factors. To save the bee
population originating from Ammellifera, the Urals and the Volga region
need to preserve the gene pool of each of the local populations we
found clean and a certain isolation from the flow of genes from the bee
populations of hybrid origin. |
032.
Ильясов
Р.А., Поскряков А.В., Николенко А.Г. Генетическая характеристика
популяций пчел Республики Башкортостан. Материалы XV Всероссийской
молодежной научной конференции "Актуальные проблемы биологии и
экологии". Сыктывкар. 2008. Т. 3. С. 102-103.
Вид
пчелы A.mellifera L. естественный ареал которого - западная палеарктика
и почти вся афротропическая зоогеографическая область, подразделяется
на 25 подвидов. Ареал распространения медоносных пчел в Европе за
последний век был подвержен значительным изменениям под воздействием
человека. В Северной Европе с начала 20 века в коммерческом
пчеловодстве стали преобладать A.m.ligustica из Италии и A.m.carnica из
бывшей Югославии [4]. В Германии массовая интродукция привела к тому,
что местный подвид A.m.mellifera был почти полностью заменен подвидом
A.m.carnica. В скандинавских странах и Великобритании большинство
пчеловодов содержат A.m.ligustica, A.m.carnica. На Урал также массово
завозились пчелы с Кавказа - A.m.caucasica. В результате таких
интродукций популяции местных пчел A.m.mellifera потеряли свою
индивидуальность из-за гибридизации. Естественный ареал A.m.mellifera в
результате значительно сократился.
Результаты
предыдущих исследований европейских популяций пчел с использованием
микросателлитных локусов и RFLP митохондриальной ДНК (мтДНК) [3]
показали, что популяции на территории Франции, Германии, Испании, Дании
и Норвегии являлись частично гибридизованными между A.m.mellifera и
каким-либо подвидом из Восточной Европы или Средиземноморья. Однако им
все же удалось обнаружить сохранившиеся популяции A.m.mellifera.
Результаты
исследований популяций пчел на Урале с использованием морфометрических
методов показали, что большинство из них состоят из гибридных семей.
Однако, предполагали, что популяции аборигенного подвида могли
сохраниться на территории Бурзянского, Янаульского районов республики
Башкортостан, а также Уинского и Вишерского районов Пермского края.
Результаты дальнейших исследований популяций пчел Урала с
использованием маркера COI-COII мтДНК показали, что в Бурзянскогм
районе действительно сохранилась аборигенная популяция A.m.mellifera
[1].
В
данной работе была поставлена цель сравнить две популяции пчел на Урале
- сохранившуюся популяцию A.m.mellifera Бурзянского района - бурзянскую
популяцию и гибридную популяцию пчел из Иглинского района - иглинскую
популяцию на основе генетических показателей, полученных с
использованием микросателлитных локусов 4a110 и ap243.
Были
проанализированы пчелы из 50 семей иглинской и 62 семей бурзянской
популяций с использованием микросателлитных локусов ap243 и 4a110.
Микросателлитный локус ap243 содержит три аллеля, которые в бурзянской
популяции встречались в соотношении 0,452: 0,315: 0,234, а в иглинской
- 0,770: 0,160: 0,070. Микросателлитный локус 4a110 содержит два
аллеля, которые в бурзянской популяции встречались в соотношении 0,581:
0,419, а в иглинской - 0,710: 0,290.
Значение
коэффициента инбридинга внутри субпопуляции (Fis) для бурзянской
популяции было равно 0,421, а иглинской популяции - 0,177. Во взятых
для сравнения популяциях A.m.mellifera Colonsay и Whitby в
Великобритании, проанализированных A.B.Jensen с соавт [3] с
использованием 11 микросателлитных локусов значение
внутрипопуляционного инбридинга (Fis) было равно 0,003 и 0,024,
соответственно. Положительное и близкое к 0 значение этого коэффициента
показывает незначительный дефицит гетерозигот и инбридинг. Из этого
можно сказать, что уровень инбридинга очень низок в европейских
популяциях A.m.mellifera, а в бурзянской популяции инбридинг выше почти
в два раза, чем в иглинской.
В
бурзянской популяции наблюдаемая гетерозиготность Hо = 0,320, а
ожидаемая гетерозиготность He = 0,565. В иглинской популяции
наблюдаемая гетерозиготность Hо = 0,330, а ожидаемая гетерозиготность
He = 0,400. таким образом, в обеих популяциях отмечается дефицит
гетерозигот. Следует отметить, что в бурзянской популяции дефицит
гетерозигот выражен в два раза сильнее, чем в иглинской, что может быть
следствием обитания при длительной изоляции в горно-лесной
географической зоне.
Коэффициент
дифференциации популяций (Fst) между бурзянской и иглинской популяциями
0,080. Для сравнения, коэффициент дифференциации популяций (Fst), при
анализе 11 микросателлитных локусов, между популяциями A.m.mellifera
Colonsay и Whitby Великобритании 0,050. Отсюда видно, что
дифференциация между бурзянской и иглинской популяциями по результатам
анализа двух микросателлитных локусов несколько выше дифференциации
популяций A.m.mellifera Великобритании.
Стандартная
генетическая дистанция M.Nei (1972) (Ds) между иглинской и бурзянской
популяциями была равна 0,080, а генетическая дистанция
L.L.Cavalli-Sforza, A.W.F.Edwards (1967) (Dce) между бурзянской и
иглинской популяциями была равна 0,152. Генетическая дистанция M.Nei
(1978) между островными популяциями A.mellifera в Германии, расчитанная
P.Neumann с соавт [4] , используя 4 микросателлитных локуса, между
матками пчел популяций Baltrum и Langeoog была равна 0,029, а между
трутнями - 0,436, то есть уровень дифференциации трутней выше уровня
дифференциации маток. Генетическая дистанция L.L.Cavalli-Sforza,
A.W.F.Edwards (1967), рассчитанная [2], используя 6 микросателлитных
локусов, между популяциями A.m.ligustica из Италии и A.m.carnica из
Югославии равна 0,510, а между популяциями A.m.ligustica из Италии и
A.m.mellifera из Франции равна 0,680. Таким образом, генетические
дистанции между бурзянской и иглинской популяциями были значительно
меньше по сравнению с дистанциями между европейскими популяциями пчел.
Таким
образом, на основе анализа вариабельности микросателлитных локусов
4а110 и ap243 были рассчитаны основные генетические характеристики для
двух популяций пчел на Урале: гибридной иглинской и аборигенной
бурзянской. Уровень дифференциации между бурзянской и иглинской
популяциями оказался выше дифференциации между популяциями
A.m.mellifera Colonsay и Whitby Великобритании. Одинаковым для обеих
сравниваемых популяций был дефицит гетерозигот и инбридинг, хотя для
бурзянской популяции эти показатели были несколько выше.
View
bee A.mellifera L. natural range which - Western Palearctic and
Afrotropical almost all zoogeographical region, subdivided into 25
sub-species. The area of distribution of honey bees in Europe over
the last century has been subject to significant changes under the
influence of man. In Northern Europe since the early 20th century began
to dominate commercial beekeeping Amligustica Amcarnica from Italy and
from the former Yugoslavia [4]. In Germany, the introduction of mass
led to the fact that the local subspecies Ammellifera was almost
completely replaced by subspecies Amcarnica. In the Scandinavian
countries and the UK, most beekeepers contain Amligustica, Amcarnica.
In the Urals and massively imported bees from Caucasus - Amcaucasica.
As a result of such introductions of local bee populations Ammellifera
lost their identity due to hybridization. Ammellifera natural habitat
as a result of significantly reduced.
Previous
studies of European bee populations using microsatellite loci and RFLP
of mitochondrial DNA (mtDNA) [3] showed that the population in France,
Germany, Spain, Denmark and Norway were partially annealed between
Ammellifera and some subspecies of Eastern Europe, or Mediterranean.
However, they still managed to find extant populations Ammellifera.
The
results of studies of bee populations in the Urals with morphometric
methods have shown that most of them consist of hybrid families.
However, it is assumed that the population of aboriginal subspecies
could be preserved in the territory Burzyansky, Yanaulskogo areas of
the Republic of Bashkortostan, as well as Uinskogo and Vishera
districts of Perm region. The results of further studies of bee
populations using the Urals marker COI-COII mtDNA showed that the area
really Burzyanskogm preserved aboriginal population Ammellifera [1].
In
this paper we set the goal to compare two populations of bees in the
Urals - keep the population Ammellifera Burzyansky area - Burzyan
population and hybrid populations of bees from iglinsky district -
Iglinskiy population based on genetic indicators obtained using
microsatellite loci and 4a110 ap243.
Bees
were analyzed from 50 families and 62 families Iglinsky Burzyan
populations using microsatellite loci and ap243 4a110. Microsatellite
loci ap243 has three alleles, which Burzyan population occurs at a
ratio of 0.452: 0.315: 0.234, and Iglinsky - 0.770: 0.160: 0.070.
Microsatellite loci 4a110 contains two alleles that are Burzyan
population occurs in a ratio of 0.581: 0.419, and Iglinsky - 0.710:
0.290.
The
coefficient of inbreeding within the subpopulation (Fis) for Burzyan
population was equal to 0.421, and Iglinsky population - 0.177. When
taken to compare populations Ammellifera Colonsay and Whitby in the UK,
analyzed ABJensen et al [3] using 11 microsatellite loci value
intrapopulation inbreeding (Fis) was equal to 0.003 and 0.024,
respectively. Positive and close to 0 value of this index shows a
slight deficit of heterozygotes and inbreeding. From this it can be
said that a very low level of inbreeding in European populations
Ammellifera, and inbreeding in the population above Burzyan almost
twice than Iglinsky.
In
Burzyan population observed heterozygosity = 0.320 But, as expected
heterozygosity He = 0,565. In Iglinsky population observed
heterozygosity = 0.330 But, as expected heterozygosity He = 0,400.
Thus, in both populations are deficient heterozygote. It should be
noted that in Burzyan population heterozygote deficiency is expressed
in two times stronger than Iglinsky, which may be a consequence of
living in long-term isolation in the mountain forest geographical area.
Coefficient
of population differentiation (Fst) between populations Burzyan and
Iglinsky 0.080. For comparison, the coefficient of population
differentiation (Fst), the analysis of 11 microsatellite loci between
populations Ammellifera Colonsay and Whitby UK 0,050. This shows that
the differentiation between populations Iglinsky Burzyan and on the
analysis of two microsatellite loci slightly higher population
differentiation Ammellifera UK.
Standard
genetic distance M.Nei (1972) (Ds) between Iglinsky and Burzyan
populations was equal to 0.080, and the genetic distance
LLCavalli-Sforza, AWFEdwards (1967) (Dce) between Burzyan and Iglinsky
populations was equal to 0.152. Genetic distance M.Nei (1978) among
island populations A.mellifera in Germany calculate P.Neumann et al
[4], using four microsatellite loci between populations of bees queens
Baltrum and Langeoog was equal to 0.029, but between drones - 0.436,
the there is a level above the level of the drones differentiation
differentiation queens. Genetic distance LLCavalli-Sforza, AWFEdwards
(1967) calculated [2], using 6 microsatellite loci between populations
Amligustica from Italy and from Yugoslavia Amcarnica is 0.510 and
between populations Amligustica from Italy and from France is
Ammellifera 0.680. Thus, the genetic distance between populations
Iglinsky Burzyan and were significantly less than the distance between
the European bee population.
Thus,
based on the analysis of variability of microsatellite loci and 4a110
ap243 were calculated for basic genetic characteristics of two
populations of bees in the Urals: Iglinsky hybrid and native Burzyan.
The level of differentiation between Burzyan and Iglinsky populations
was higher differentiation between populations Ammellifera Colonsay and
Whitby UK. The same for both populations was compared deficit of
heterozygotes and inbreeding, although Burzyan population these figures
were slightly higher. |
031.
Ильясов
Р.А., Поскряков А.В., Николенко А.Г. Филогенетика и структура популяции
пчел на Урале. Материалы докладов молодежной научной конференции:
"Экологические проблемы Севера". Архангельск. 2008. С. 179-182.
Темная
европейская или среднерусская пчела (подвид Apis mellifera mellifera
L.) до вмешательства человека занимала почти всю Северную Европу. В
Европе и России подвид A.m.mellifera был подвержен интенсивной
гибридизации благодаря завозу пчел из Южной и Восточной Европы, в
результате чего были утрачены его ценные качества. А.В.Петухов с соавт.
(1996) и А.Г.Николенко и А.В.Поскряков (2002) показали возможность
сохранения популяции A.m.mellifera на Урале.
Для
определения настоящего состояния популяций среднерусской пчелы на Урале
мы использовали ПЦР-анализ полиморфизма двух микросателлитных локусов
ар243 и 4а110 ядерной ДНК, фрагмента гена второй субъединицы
NADH-дегидрогеназы (ND2) и локуса, расположенного между генами цитохром
оксидазы I и II (межгенный локус COI-COII) митохондриальной ДНК
(мтДНК). Были проанализированы пчелы из 550 семей с 11 пасек 3 районов
Республики Башкортостан и с 11 пасек 7 районов Пермского края.
Ранее
было показано (Cornuet et al., 1991), что подвиду A.m.mellifera
соответствует комбинация элементов PQQ межгенного локуса COI-COII, а
южным подвидам (Apis mellifera ligustica Spinola, Apis mellifera
caucasica Gorbatschev и Apis mellifera carnica Pollmann) –
только один
элемент Q. Пчелы с пасек Уинского района Пермского края и Иглинского
района Республики Башкортостан характеризовались относительно низкой
частотой встречаемости комбинации PQQ 0,71 и 0,57, соответственно, что
вызвано, несомненно гибридизацией. Иглинская популяция также, в целом,
оказалась гибридной, хотя пасеки Кугейко и Орловская характеризовались
довольно высокой частотой встречаемости комбинации PQQ (0,90 и 0,93,
соответственно). Вместе с тем данные пасеки не могли быть отнесены к
популяции A.m.mellifera, так как расположены в массовом окружении пасек
с гибридными семьями, между которыми возможен интенсивный поток генов.
Наиболее высокой частотой встречаемости комбинации PQQ (свыше 0,98)
характеризовались пасеки Вишерского района Пермского края - вишерская
популяция A.m.mellifera, пасеки Нытвенского, Пермского, Ординского,
Осинского и Частинского районов Пермского края - южно-прикамская
популяция A.m.mellifera, пасеки и борти Бурзянского района Республики
Башкортостан - бурзянская популяция A.m.mellifera, а также пасеки
Татышлинского района Республики Башкортостан - татышлинская популяция
A.m.mellifera. Высокий уровень частоты встречаемости комбинации PQQ на
пасеках позволяет говорить о существовании на данный момент, как
минимум, четырех сохранившихся популяций A.m.mellifera на Урале:
вишерской, южно-прикамской, татышлинской и бурзянской.
Обнаружение
четырех сохранившихся популяций A.m.mellifera на Урале позволило нам
приступить к следующей задаче – генетической характеристике
этих
популяций на основе микросателлитных локусов 4a110 (Haberl, Tautz,
1999) и ap243 (Solignac et al., 2003) ядерной ДНК. Как известно,
микросателлитные маркеры позволяют выявлять генетическую дифференциацию
близкородственных популяций или экологических групп одного вида, а
также подвидов (Bernatchez et al., 1998; Brunner et al., 1998, Primmer
et al., 1999). В качестве контроля была использована уже точно
известная гибридная иглинская, объединяющую пасеки иглинского района
Республики Башкортостан, а также уинскую популяции, состоящую из пасек
Уинского района Пермского края.
Мы
изучили вариабельность микросателлитных локусов ap243 и 4а110 ядерной
ДНК в популяциях пчел на Урале. По критерию значимости Пирсона
χ2 и
вероятности Р только одна вишерская популяция находилась в равновесии,
вероятность Р которой равна 0,173. Во всех остальных популяциях
P<0,05.
Генетические
расстояния Cavalli-Sforza and Edwards между всеми популяциями пчел на
Урале изменялись от 0,043 между Бурзянской и Уинской до 0,212 между
Татышлинской и Иглинской популяциями. На основе полученных генетических
расстояний была построена дендрограмма с использованием метода
кластеризации ближайшего соседа, графически отображающая генетические
отношения между популяциями, на которой Иглинская популяция
располагалась отдельно от всех остальных популяций, что, возможно,
являлось следствием гибридизации. Уинская популяция, ранее определенная
по митохондриальной ДНК как гибридная, по микросателлитным локусам
ядерной ДНК характеризовались, как A.m.mellifera, причем была очень
сходной с Бурзянской популяцией. Такое явление можно объяснить
миграцией трутней с соседних пасек Уинского района Пермского края, в
которых высокое содержание A.m.mellifera, например, с пасек из
описанных ранее А.В.Петуховым в заказнике «Малиновый
хутор». Среди
популяций наблюдалась определенная группировка, где Татышлинская была
наиболее генетически близка к Южно-Прикамской, а Вишерская, Бурзянская
и Уинская были наиболее сходны между собой. Следует отметить, что
наблюдаемая дифференциация очень незначительная, по сравнению с
дифференциацией Иглинской популяции. Таким образом, по ядерной ДНК
подтверждается особенность Уинской популяции, ранее описанная
А.В.Петуховым и опровергнутая нами по данным митохондриальной ДНК.
Возможно, что в Уинском районе Пермского края в заказнике
«Малиновый
Хутор» сохранилась еще одна популяция A.m.mellifera.
Коэффициент
дифференциации Fst (Cockerham, 1973; Weir, Cockerham, 1984) между
популяциями изменялись в пределах от -0,001 до 0,171. Наименее
дифференцированными были Вишерская и Бурзянская, Татышлинская и
Южно-Прикамская, Бурзянская и Уинская, значения Fst которых были очень
близки к 0. Наиболее дифференцированной от всех была Иглинская
популяция, значения Fst которой изменялись от 0,076 между Бурзянской и
Иглинской до 0,171 между Татышлинской и Иглинской. Значения Fst
значительно коррелируют с генетическими расстояниями, однако значения
Fst тут приводятся для возможности сопоставления с другими данными, так
как во многих публикациях приводится только матрица Fst, на основе
которой и строится дендрограмма. Наблюдаемая гетерозиготность Ho
немного меньше ожидаемой гетерозиготности для субпопуляций Hs и всей
популяции Ht, что свидетельствует о дефиците гетерозигот. Дефицит
гетерозигот также показывает и положительное значение коэффициента
инбридинга для субпопуляций Fis и тотальной популяции Fit. Кроме того,
значения Fis и Fit являются показателями незначительного отклонения
распределение генотипов от равновесия Харди-Вайнберга всей популяции
пчел на Урале (при равновесии Харди-Вайнберга значение Fis и Fit равно
0). Коэффициент дифференциации для всей популяции пчел на Урале Fst
имеет близкое к 0 значение, что является показателем очень
незначительной генетической дифференциации популяций.
В
ходе секвенционного анализа амплифицированного фрагмента гена ND2 мтДНК
медоносной пчелы была определена его нуклеотидная последовательность со
средним размером 688 п.н. Нуклеотидные последовательности
просеквенированных фрагментов гена ND2 мтДНК пчел были депонированы в
международный генбанк NCBI (http://www.ncbi.nlm.nih.gov) (Ilyasov et
al., 2005; Ilyasov et al., 2006). При сравнении по данной
последовательности уральских пчел A.m.mellifera наблюдалось 5
нуклеотидных замен., где замена Т на С в позиции 536 двух уральских
пчел DQ181614 и DQ181618 приводила к замене в аминокислотной
последовательности в положении 12 аминокислоты изолейцин (Ile) на
треонин (Thr). На дендрограмме, построенной по результатам сравнения
нуклеотидных последовательностей фрагмента гена ND2 не наблюдалось
дифференциации между представителями разных локальных популяций
A.m.mellifera на Урале, что является показателем их тесного
генетического родства. В дальнейшем нами сравнивались
последовательности A.m.mellifera уральских популяций со всеми
доступными в генбанке NCBI последовательностями большинства подвидов
A.mellifera. На полученной дендрограмме наблюдалась группировка
образцов на четыре эволюционные ветви, сходная с подразделением
подвидов A.mellifera, предложенного F.Ruttner et al. (1978). Однако по
подвидовому составу групп наблюдались различия. Подвидовой состав
четырех эволюционных ветвей предложенных M.C.Arias, W.S.Sheppard
(1996), P.Franck et al. (2000) с использованием этого же локуса
оказался очень похожим на наш.
Представители
уральских и европейских популяций A.m.mellifera кластеризовались в одну
группу, названную эволюционной ветвью М. Но от ветви М, предложенной
F.Ruttner et al. (1988), она отличалась тем, что в ее состав вошел
только один единственный подвид - A.m.mellifera. Большинство
представителей африканских подвидов пчел объединились во вторую группу,
названную эволюционной ветвью А, по аналогии с F.Ruttner et al. (1988),
хотя по составу подвидов наблюдались определенные различия. Эта ветвь
разделилась на две подгруппы, объединяющие северо-африканские и
южно-африканские подвиды, что сходно с группировкой M.C.Arias,
W.S.Sheppard (1996). Однако, в отличие от группировки последних
авторов, мы еще наблюдали третью африканскую группу, объединяющую пчел
Центральной Африки - Apis mellifera adansonii Latreille из Сенегала и
Apis mellifera scutellata Lepeletier из Кении. От основания ветви А
отделилась небольшая группа, куда вошли Apis mellifera meda Skorikov из
Сирии, Apis mellifera syriaca Buttel-Reepen из Сирии и Apis mellifera
lamarckii Cockerell из Египта, названная эволюционной ветвью О. Эта
ветвь по составу подвидов также имела отличия от ветви О, предложенной
F.Ruttner et al. (1988). В четвертую многочисленную группу, названную
эволюционной ветвью С, вошли пчелы Средиземноморья, Ближнего Востока и
Кавказа. Эта эволюционная ветвь по составу подвидов отличалась от
состава ветви С, предложенного F.Ruttner et al. (1988). Сравнительный
анализ нуклеотидной последовательности фрагмента гена ND2 мтДНК
подвидов A.mellifera и двух видов пчел Apis cerana Fabricius и
Mellipona bicolor Lepeletier показал, что наиболее близкими к предковой
форме вида A.mellifera являлись представители эволюционной ветви С.
Также было показано, что Apis cerana не является предковым видом по
отношению к A.mellifera: они относятся друг к другу как сестринские
виды.
Таким
образом, на основе анализа митохондриальной ДНК были выделены 4
сохранившиеся популяции A.m.mellfera на Урале: бурзянская,
татышлинская, южно-прикамская и вишерская. Привлечение микросателлитных
локусов ядерной ДНК позволило предположить, что в Уинском районе
Пермского края имеется большая вероятность сохранения популяций
A.m.mellfera. Детальное исследование пчел этого района, возможно,
позволит нам выделить пятую сохранившуюся популяцию A.m.mellfera на
Урале. По генетическим характеристикам, Уинская популяция наиболее
сходна с Бурзянской популяцией A.m.mellfera. В целом, популяции
A.m.mellfera на Урале характеризуются незначительной генетической
дифференциацией, отклонением от равновесия Харди-Вайнберга, которое
является, возможено результатом небольшого инбридинга в популяциях, что
характерно для большинства пчел. Филогенетический анализ по локусу
мтДНК показал генетическое родство уральских и западноевропейских
популяций A.m.mellifera. Возможно, что подвид A.m.mellifera является
единственным представителем внутривидовой эволюционной ветви М, а
предковой формой подвидов Apis mellifera L. могут быть пчелы
эволюционной ветви С.
Dark
or the European Central Russian bee (subspecies Apis mellifera
mellifera L.) to human intervention occupied almost the whole of
Northern Europe. In Europe and Russia subspecies Ammellifera was
subject to intense hybridization due to deliver their bees from
Southern and Eastern Europe, resulting in lost his valuable quality.
A.V.Petuhov et al. (1996) and A.G.Nikolenko and A.V.Poskryakov (2002)
have shown the ability to maintain the population Ammellifera the Urals.
To
determine the population status of the Central Russian bees in the
Urals, we used PCR analysis of microsatellite loci polymorphism two
ar243 4a110 and nuclear DNA gene fragment of a second subunit of
NADH-dehydrogenase (ND2) and locus located between the genes cytochrome
oxidase I and II (intergenic locus COI- COII) mitochondrial DNA
(mtDNA). Bees were analyzed from 550 families with 11 apiaries 3
districts of the Republic of Bashkortostan and 11 apiaries 7 districts
of Perm region.
It
was shown earlier (Cornuet et al., 1991), which corresponds to the
subspecies Ammellifera combination of elements PQQ intergenic locus
COI-COII, and southern subspecies (Apis mellifera ligustica Spinola,
Apis mellifera caucasica Gorbatschev and Apis mellifera carnica
Pollmann) - only one element Q . Bee apiaries with Uinskogo district of
the Perm Region and the Republic of Bashkortostan iglinsky district
characterized by a relatively low incidence of a combination of PQQ
0,71 and 0.57, respectively, which caused no doubt by hybridization.
Iglinskiy population as well as a whole, was a hybrid, though apiary
Kugeiko and Orel were characterized by a relatively high incidence of
combination PQQ (0,90 and 0,93 respectively). However, data apiary
could not be attributed to population Ammellifera, because they are
located in large apiaries surrounded hybrid families between which the
intense gene flow. The highest incidence of the combination PQQ (over
0.98) were characterized apiary Vishera district of the Perm region -
Visherskaya population Ammellifera, apiary Nytvensky, Perm, Orda, Osa
and Perm Territory Chastinskogo areas - South Prikamskaya population
Ammellifera, apiary and board Burzyansky area Republic of Bashkortostan
- Burzyan population Ammellifera, and apiary Tatyshlinskogo district of
Bashkortostan - tatyshlinskaya population Ammellifera. The high level
of incidence of a combination of PQQ on apiaries suggests the existence
of at the moment, at least, the four remaining populations of the Urals
Ammellifera: Vishera, Kama region of the South, and tatyshlinskoy
Burzyan.
Finding
four remaining populations in the Urals Ammellifera allowed us to
proceed to the next task - the genetic characteristics of these
populations based on microsatellite loci 4a110 (Haberl, Tautz, 1999)
and ap243 (Solignac et al., 2003) of nuclear DNA. It is known that
microsatellite markers allow detection of closely related genetic
differentiation of populations or environmental groups of one species
and subspecies (Bernatchez et al., 1998; Brunner et al., 1998, Primmer
et al., 1999). As a control was used already known hybrid Iglinskiy
uniting apiary iglinsky district of the Republic of Bashkortostan, as
well as uinskuyu population consisting of apiaries Uinskogo district of
the Perm region.
We
have studied the variability of microsatellite loci ap243 4a110 and
nuclear DNA in populations of bees in the Urals. On the criterion of
the importance of the Pearson χ2 probability P and only one
Visherskaya
population is in equilibrium, the probability P is equal to 0.173. In
all other populations P <0,05.
Genetic
distances Cavalli-Sforza and Edwards among all populations of bees in
the Urals varied from between 0,043 and Burzyan Uinskoy to between
0.212 and Tatyshlinskoy Iglinsky populations. On the basis of genetic
distance dendrogram was built using the nearest neighbor method,
clustering, graphically showing the genetic relationships between
populations, which Iglinskiy population separate from the rest of the
population, which may be a consequence of hybridization. Uinskaya
population previously defined by the mitochondrial DNA as a hybrid,
according to nuclear DNA microsatellite loci characterized as
Ammellifera, and was very similar to Burzyan population. This
phenomenon can be explained by migration from neighboring apiaries
drones Uinskogo district of the Perm region, where high levels of
Ammellifera, such as apiaries of the previously described A.V.Petuhovym
in reserve "Raspberry Farm." Among the population there is a certain
group where Tatyshlinskaya was the most genetically similar to the
South-Kama region and Visherskaya, Burzyan and Uinskaya were the most
similar. It should be noted that the observed differentiation very
small compared with the differentiation Iglinsky population. Thus,
nuclear DNA confirmed feature Uinskoy population previously described
A.V.Petuhovym refute contact according to mitochondrial DNA. It is
possible that in the near Uinskom Perm edge in the reserve 'Raspberry
Farm "survived another population Ammellifera.
Differentiation
factor Fst (Cockerham, 1973; Weir, Cockerham, 1984) between populations
ranged from 0.001 to 0.171. The least differentiated and were
Visherskaya Burzyan, Tatyshlinskaya and South Prikamskaya, Burzyan and
Uinskaya, Fst values were very close to 0. The most differentiated
from all was Iglinskiy population, Fst values that vary from between
0,076 and Burzyan Iglinsky to between 0.171 and Tatyshlinskoy Iglinsky
. Fst values significantly correlated with the genetic distances, but
there are Fst values to allow comparison with other data, as in many
publications is only the matrix Fst, on the basis of which the
constructed dendrogram. The observed heterozygosity Ho slightly less
than expected heterozygosity for subpopulations and the entire
population Hs Ht, indicating a deficit of heterozygotes. The deficit of
heterozygotes, and also shows a positive coefficient of inbreeding for
subpopulations Fis and total population Fit. In addition, the values
of Fis and Fit are indicative of a slight deviation of the
distribution of genotypes from Hardy-Weinberg equilibrium of the entire
population of bees in the Urals (in the Hardy-Weinberg equilibrium
value of Fis and Fit is 0). Differentiation factor for the entire
population of bees in the Urals has Fst value close to 0, which is
indicative of very little genetic differentiation of populations.
During
sekventsionnogo analysis amplified gene fragment ND2 mtDNA honeybee was
determined its nucleotide sequence with an average size of 688 bp The
nucleotide sequence of the gene fragment sequenced ND2 mtDNA bees were
deposited at an international genebank NCBI
(http://www.ncbi.nlm.nih.gov) (Ilyasov et al., 2005; Ilyasov et al.,
2006). A comparison of the sequence of the Ural observed bees
Ammellifera 5 nucleotide substitutions., Where the replacement of the T
of C at position 536 of the two Ural bees DQ181614 and DQ181618 leads
to the substitution in the amino acid sequence of the amino acid at
position 12, isoleucine (Ile) to threonine (Thr). In the dendrogram
constructed by comparing the nucleotide sequences of the gene fragment
ND2 observed differentiation between different local populations
Ammellifera in the Urals, which is indicative of their close genetic
relationship. In the future, we compared the sequence Ammellifera Ural
population with all available in the NCBI GenBank sequences of most
subspecies A.mellifera. On the resulting dendrogram observed grouping
samples into four evolutionary branch, similar to the division of
subspecies A.mellifera, proposed F.Ruttner et al. (1978). However, the
composition of teams subspecies observed differences. Part of the four
subspecies of evolutionary branches proposed MCArias, WSSheppard
(1996), P.Franck et al. (2000) using the same locus was very similar to
ours.
The
representatives of the Ural and European populations Ammellifera
clustered into one group called evolutionary branch from the branch M.
But M proposed F.Ruttner et al. (1988), it is different in that its
composition entered only a single subspecies - Ammellifera. Most of the
African sub-species of bees in the second group came together, called
evolutionary branch A, by analogy with the F.Ruttner et al. (1988),
although the composition of certain subtypes observed differences. This
branch was divided into two subgroups, combining North African and
South African subspecies, which is similar to grouping MCArias,
WSSheppard (1996). However, unlike the latter group of authors, we have
seen a third of the African Group combining the Central African bees -
Apis mellifera adansonii Latreille from Senegal and Apis mellifera
scutellata Lepeletier from Kenya. From the base of the branches and the
Division of a small group which included Apis mellifera meda Skorikov
Syria, Apis mellifera syriaca Buttel-Reepen from Syria and Apis
mellifera lamarckii Cockerell of Egypt, called evolutionary branch O.
This branch sub-species composition also had differences from branch
Oh, proposed F.Ruttner et al. (1988). The fourth largest group, called
evolutionary branches with, bee entered the Mediterranean, the Middle
East and the Caucasus. This evolutionary branch composition subspecies
differs from that of branches from the proposed F.Ruttner et al.
(1988). Comparative analysis of the nucleotide sequence of the gene
fragment ND2 mtDNA subspecies A.mellifera and two species of bees Apis
cerana Fabricius and Mellipona bicolor Lepeletier showed that closest
to the ancestral form A.mellifera species were representatives
evolutionary branch C has also been shown that not the Apis cerana
ancestral views with respect to A.mellifera: they refer to each other
as sister species.
Thus,
based on analysis of mitochondrial DNA have been allocated 4 Ammellfera
keep the population in the Urals: Burzyan, tatyshlinskaya, South
Prikamskaya and Visherskaya. Attraction nuclear DNA microsatellite loci
suggested that in Uinskom district of Perm Krai there is a great
probability of sustaining populations Ammellfera. A detailed study of
the bees in the area, may allow us to identify the fifth Ammellfera
keep the population in the Urals. Genetic characteristics Uinskaya
population most similar to the population Burzyan Ammellfera. Overall,
the population in the Urals Ammellfera characterized by low genetic
differentiation, deviation from Hardy-Weinberg equilibrium, which is
possible result of inbreeding in small populations, which is typical
for the majority of bees. Phylogenetic analysis of mtDNA locus showed
the genetic relationship of the Urals and Western European populations
Ammellifera. Perhaps Ammellifera subspecies is the only representative
of intraspecific evolutionary branches of M and the ancestral form of
the subspecies Apis mellifera L. bees may be evolutionary branch C. |
030.
Ильясов Р.А.,
Поскряков А.В., Николенко А.Г. Динамика изменения частот генов
антибактериального пептида в популяции пчел на Урале. Материалы IV
международной конференции "Биоразнообразие и биоресурсы Урала и
сопредельных территорий". Оренбург. 2008. С. 134-136.
Болезнетворные
бактерии пчел широко распространены в почве, воде, воздухе и пище. В
большинстве случаев бактерии попадают в полость тела пчелы через
поглощаемый корм. Бактерии могут инфицировать пчел и через дыхальца или
даже через раны, наносимые внешними паразитами – клещами
Varroa
jacobsoni [1]. Любое ранение кутикулы или пищеварительного тракта
является входным путем для бактерий.
Личинки
медоносных пчел могут быть поражены американским гнильцом Paenibacillus
larvae larvae, европейским гнильцом Mellissococcus pluton, Bacillus
pulvifaciens, а взрослые пчелы - Pseudomonas aeruginosa, Hafnia alvei,
Enterococcus faecalis. Сапрофитные и патогенные бактерии растений могут
также случайно индуцировать болезни пчел при попадании в полость тела.
Как
известно, пчелы продуцируют антибактериальные пептиды для защиты от
микроорганизмов. На данный момент у пчел известны антибактериальные
пептиды - абецин, дефензин и гименоптецин, которые, по Б.В.Зюману
(1992), являются необходимыми компонентами групповой и индивидуальной
системы иммунитета пчелиной семьи. C.S.McCleskey, R.M.Melampy (1938) и
H.Yamauchi (2001) продемонстрировали антибактериальные свойства
маточного молочка пчел, секретируемого фарингеальными железами, которое
активно против бактерий и грибков. K.Casteels-Johnson с соавт. (1994)
изучали в гемолимфе у пчел, инфицированных Escherichia coli, четыре
различных типа антимикробных каталитических пептидов –
апидацин,
гименоптецин, абецин и дефензин.
Антибактериальный
пептид дефензин объединяет большое семейство цистеин-богатых
каталитических антимикробных пептидов, воздействующих на разнообразные
микроорганизмы, составляющих основную защитную систему большинства
организмов. Дефензины пчел - пептиды длиной 36-51 аминокислот,
обладающие сходством последовательности, основная структура которых
состоит из концевых аминокислотных повторов, альфа-спирали и двух
антипараллельных цепочек, стабилизированных 3-дисульфидными мостиками
[2]. Дефензин обычно продуцируется последним из всех, но его активность
продолжается свыше двух недель после инфекции [3]. Дефензин гемолимфы и
его предшественник про-пептид были охарактеризованы по кДНК, выделенных
из брюшной полости инфицированных пчел [4].
Другой
дефензин пчел, названный роялизином, был выделен из маточного молочка
пчел и был охарактеризован S.Fujiwara с соавт. (1990) на уровне
пептидов. Оба дефензина пчел содержали 51 аминокислоту. Они отличались
по одной аминокислоте и по группе, состоящей из двух аминокислот при
сравнении последовательностей, представленных в международном GeneBank
(http://www.ncbi.nlm.nih.gov). Пчелиный дефензин, также как шмелиный,
был амилирован и имел дополнительное удлинение на 11 аминокислот с
С-конца, что было несхоже с другими насекомыми. Оказалось, что роялизин
очень активен против грамотрицательных бактерий и неэффективен против
грамположительных. Также была описана антигрибковая активность
пчелиного роялизина [5] и его антибактериальная активность к патогену
Paenibacillus larvae, который является возбудителем болезни личинок
пчел.
А.В.Львов
и А.Г.Николенко (2000) обнаружили существование двух, ранее не
известных, аллельных форм А и В фрагмента гена дефензина. J.Klaudiny с
соавт. (2005) изучили нуклеотидную и аминокислотную последовательности
гена дефензина 1 и показали, что обнаруженный ими антибактериальный
пептид отличался от дефензина, описанного А.В.Львовым и А.Г.Николенко
(2000), заменой T на A в положении 1471, которая приводила к
аминокислотной замене Leu на His; отличался от дефензина, описанного
K.Casteels-Johnson с соавт. (1994) нуклеотидными заменами GGAGT на
TTAGA в положении 1507–1511, которые приводят к
аминокислотной замене
GlyVal на ValGly; отличался от роялизина, описанного S.Fujiwara с
соавт. (1990), нуклеотидными заменами СG на TA в положении
1832–1833,
которые приводят к аминокислотной замене Arg на Tyr. Кроме того, они
показали, что ранее известные дефензин и роялизин были не чем иным, как
полиморфными формами дефензина 1, тогда как обнаруженная ими новая
последовательность гена дефензина 2 лишь на 55,8% сходна с
последовательностью дефензина 1 и являлся геном новой формы дефензина.
Дефензин 1 обладал уникальной среди артропод экзон-интронной
структурой. Оба дефензина экспрессировались в голове и груди. Дефензин
1 обнаружен в гипофаренгиальных, мандибулярных и грудных слюнных
железах пчел, тогда как дефензин 2 отсутствовал. Различная
представленность этих генов отражает тканезависимую экспрессию
дефензина.
Мы
изучили вариабельность фрагмента гена дефензина ядерной ДНК в
популяциях A.m.mellifera на Урале. В исследовании наблюдалось два
аллеля этого локуса. Аллель В фрагмента гена дефензина ядерной ДНК
встречался с частотой 0,14-0,25, а аллель А – с частотой
0,75-0,86. В
работе А.В.Львова и А.Г.Николенко (2002) частота аллелей фрагмента гена
дефензина ядерной ДНК в популяциях пчел на Урале распределялась более
равномерно: аллель B встречался с частотой 0,25-0,45, а аллель A
–
0,55-0,75. Для более детального сравнения можно показать, что работах
А.В.Львова и А.Г.Николенко (2002) в западной и северо-восточной
популяциях пчел на Урале частота встречаемости аллелей B и А фрагмента
гена дефензина ядерной ДНК была 0,25 и 0,75, соответственно, в
янаульской - 0,45 и 0,55, в бурзянской – 0,41 и 0,59, в
иглинской –
0,32 и 0,68. В нашем исследовании в бурзянской и иглинской популяциях
аллель В фрагмента гена дефензина ядерной ДНК встречался с частотой
значительно меньшей таковых в работе А.В.Львова (2002). Различалось
также распределение генотипов фрагмента гена дефензина ядерной ДНК в
популяциях. В нашей работе генотип ВВ фрагмента гена дефензина ядерной
ДНК встречался с частотой 0,06-0,11, генотип АА - 0,61-0,80, генотип АВ
- 0,12-0,29, тогда как в работе А.В.Львова и А.Г.Николенко (2002)
генотип ВВ встречался с частотой 0,00-0,28, генотип АА - 0,35-0,75,
генотип АВ – 0,16-0,48.
Причину
такого распределения аллелей и генотипов фрагмента гена дефензина
ядерной ДНК на данный момент очень сложно однозначно объяснить, но
можно предположить, что популяция пчел на Урале за несколько лет
претерпела некоторые изменения, которые, возможно, связаны с
особенностями организации и развития популяций пчел, как общественных
насекомых, а также с глобальными изменениями экосистем и загрязнением
окружающей среды.
Pathogenic
bacteria bees are common in soil, water, air and food. In most cases,
the bacteria enter the body cavity through the bees forage absorbable.
The bacteria can infect the bees through spiracles, or even through the
wound inflicted by external parasites - mites Varroa jacobsoni [1]. Any
injury or cuticle of the digestive tract is input by bacteria.
Honeybee
larvae may be affected by American foulbrood Paenibacillus larvae
larvae, European foulbrood Mellissococcus pluton, Bacillus
pulvifaciens, and adult bees - Pseudomonas aeruginosa, Hafnia alvei,
Enterococcus faecalis. Saprophytic and plant pathogenic bacteria can
also induce the disease of bees accidentally when released into the
body cavity.
As
is known, bees produce antimicrobial peptides to protect against
microorganisms. At the moment, the bees are known antimicrobial
peptides - abetsin, defensin and gimenoptetsin which in B.V.Zyumanu
(1992), are essential components of group and individual bee colony
immune system. CSMcCleskey, RMMelampy (1938) and H.Yamauchi (2001)
demonstrated the antibacterial properties of royal jelly bee secreted
by pharyngeal glands, which is active against bacteria and fungi.
K.Casteels-Johnson et al. (1994) studied in the hemolymph of bees
infected with Escherichia coli, four different types of antimicrobial
peptides catalyst - apidatsin, gimenoptetsin, abetsin and defensin.
Defensin
antimicrobial peptides brings together a large family of cysteine-rich
catalytic antimicrobial peptides that act on a variety of
micro-organisms that make up the bulk of most organisms defense system.
Defensins bees - 36-51 amino acid long peptides having sequence
similarity, the main structure consisting of repeats terminal amino
acid alpha-helices and two antiparallel chains, stabilized by 3
disulfide bridges [2]. Defensins typically produced last of all, but
its activity continues for more than two weeks after infection [3].
Defensin hemolymph and its precursor pro-peptide have been
characterized by cDNA isolated from abdominal cavity of infected bees
[4].
Another
defensin bees called royalizinom was isolated from royal jelly and bee
was characterized S.Fujiwara et al. (1990) at the level of peptides.
Both defensin bees contained 51 amino acids. They differ by one amino
acid and the group consisting of two amino acids when comparing the
sequences shown in international GeneBank
(http://www.ncbi.nlm.nih.gov). Beeswax defensin, as hornet was
amilirovan and had an elongation of 11 additional amino acids to the
C-terminus that was dissimilar to other insects. It turned out that
royalizin very active against Gram-negative bacteria and is ineffective
against Gram-positive. Also described antifungal activity of bee
royalizina [5] and its antibacterial activity to a pathogen
Paenibacillus larvae, that is larvae bee pathogen.
A.V.Lvov
and A.G.Nikolenko (2000) found the existence of two previously unknown,
allelic forms A and B gene fragment of defensin. J.Klaudiny et al.
(2005) examined the nucleotide and amino acid sequences defensin 1 gene
and showed that they have detected an antibacterial peptide differed
from defensin described A.V.Lvovym and A.G.Nikolenko (2000), by
replacing T with A at position 1471, which resulted in amino acid
substitution of Leu for His; different from the defensin described
K.Casteels-Johnson et al. (1994) at nucleotide substitutions GGAGT
TTAGA at position 1507-1511, which result in an amino acid substitution
at GlyVal ValGly; different from royalizina described S.Fujiwara et al.
(1990), nucleotide substitutions CG to TA at position 1832-1833, which
result in amino acid substitution of Arg for Tyr. In addition, they
showed that the previously known defensin and royalizin were nothing
like polymorphs defensin 1, whereas they discovered a new gene sequence
defensin 2 by only 55.8% similar to the sequence of defensin 1 and was
a new form of defensin gene. Defensin 1 possessed unique among
arthropods exon-intron structure. Both defensin expressed in the head
and chest. 1 defensins found in gipofarengialnyh, mandibular and
thoracic salivary glands of bees, while defensin 2 was absent.
Different representations of these genes reflects tkanezavisimuyu
defensin expression.
We
have studied the variability of defensin gene fragments of nuclear DNA
in populations Ammellifera the Urals. The study observed the two
alleles of this locus. Alleles in the gene fragment of defensin nuclear
DNA occurs with a frequency 0,14-0,25 and allele - with the frequency
of 0,75-0,86. The paper A.V.Lvova and A.G.Nikolenko (2002), the
frequency of allele gene fragment of defensin nuclear DNA in
populations of bees in the Urals are more evenly distributed: B allele
occurs with a frequency 0.25-0.45, and allele A - 0 , 55-0,75. For a
more detailed comparison, we can show that works and A.V.Lvova
A.G.Nikolenko (2002) in the western and north-eastern populations of
bees in the Urals, the frequency of allele B and A gene fragment of
defensin nuclear DNA was 0.25 and 0 , 75, respectively, YANAULSKY -
0.45 and 0.55, in Burzyan - 0.41 and 0.59, in Iglinsky - 0.32 and 0.68.
In our study, in Burzyan and Iglinsky allele in populations defensin
gene fragment nuclear DNA occurs with a frequency significantly lower
than that in the A.V.Lvova (2002). Also differ in the distribution of
genotypes defensin gene fragments of nuclear DNA in populations. In our
work genotype BB defensin gene fragment nuclear DNA met frequency
0,06-0,11 genotype AA - 0,61-0,80 genotype AB - 0,12-0,29, whereas the
AV .Lvova and A.G.Nikolenko (2002) met with BB genotype frequency of
0,00-0,28, genotype AA - 0,35-0,75, genotype AB - 0,16-0,48.
The
reason for this distribution of alleles and genotypes of defensin gene
fragments of nuclear DNA at the moment is very difficult to clearly
explain, but it can be assumed that the population of bees in the
Urals, in a few years has undergone some changes that may be associated
with features of the organization and development of populations of
bees, both public insects, as well as global changes of ecosystems and
environmental pollution. |
029.
Ильясов Р.А.,
Поскряков А.В., Николенко А.Г. Бурзянский экотип бортевой пчелы
среднерусской расы Apis mellifera mellifera L. Материалы международной
конференции "Биоразнообразие, проблемы экологии горного алтая и
сопредельных регионов: настоящее, прошлое, будущее". Горно-Алтайск.
2008. С. 94-96.
Одной
из наиболее интересных для человека групп насекомых являются пчелы -
свыше 16000 современных видов [1], но только вид Apis mellifera L. стал
широко использоваться человеком в сельскохозяйственном разведении во
всем мире.
Обширный
естественный ареал медоносной пчелы охватывает всю Африку, Европу и
Ближний Восток. Следствием этого явилась значительная внутривидовая
дифференциация [2], на данный момент общепризнано существование 25
подвидов. На территории Европы известно существование 9 подвидов
A.mellifera, 8 из которых обитает в Южной и Центральной Европе. Только
1 подвид Apis mellifera mellifera L. - темная европейская, темная
лесная, она же среднерусская пчела - освоил лесостепную и лесную зоны
Северной Европы, что делает его очень ценным для пчеловодства в
северных странах. Ещё двести лет назад этот подвид занимал в Евразии
огромную территорию вдоль северной границы естественного ареала вида.
Эволюция A.m.mellifera протекала в суровых климатических условиях, в
результате чего подвид стал отличаться исключительно высокой
зимостойкостью, приспособленностью к использованию короткого бурного
медосбора с липы, устойчивостью к нозематозу, варроатозу, аскосферозу и
падевому токсикозу.
К
сожалению, в результате непрерывного интенсивного импорта пчел с юга в
северные регионы произошла массовая гибридизация пчёл. В Германии
массивный импорт A.m.carnica в 1840-х годах привел почти к полной
замене местных пчел A.m.mellifera [3]. В скандинавских странах и на
Британских островах на большей части территории также вместо
аборигенных пчел A.m.mellifera разводят A.m.ligustica и A.m.carnica [4,
5, 6].
Такая
же ситуация сложилась и в России. Массовый завоз южных подвидов пчел в
северные регионы был организован в период породного районирования пчел.
В разработке плана породного районирования пчел в 1964-1975 гг. под
руководством Научно-исследовательского института пчеловодства принимали
участие научно-исследовательские и опытные учреждения, республиканские
и областные конторы пчеловодства. В результате массового завоза пчел из
южных районов в лесную и лесостепную зоны России, прежний ареал пчелы
среднерусской расы оказался заселен в основном пчёлами гибридного
происхождения.
Пчела
среднерусской расы A.m.mellifera в России представлена несколькими
сохранившимися локальными популяциями. Одной из них является бурзянская
популяция бортевых пчел, сохранившаяся в горно-лесной зоне Республики
Башкортостан. В работах Г.А.Кожевникова (1929, 1931) подчеркивалось,
что эта популяция пчел исключительно чистая за счет более чем
1000-летней изоляции. Интерес к среднерусской пчеле, в особенности к её
бурзянским и верхнекамским экотипам, в последние годы усиливается,
значительно возрос спрос на пчел и маток этого подвида. Правительство
РБ, администрации Бурзянского района и заповедника Шульган-Таш уделяют
большое внимание сохранению бурзянской популяции пчел. Большую помощь
оказывают также международные организации, в частности Всемирный фонд
охраны дикой природы (WWF).
На
территории заповедника ведется племенная работа, администрацией района
издан указ о запрете на ввоз пчел других подвидов, в 1997 году создан
заказник Алтын солок. В настоящее время намечается расширение
территории заповедника Шульган-Таш, что поможет сохранить биологическое
и ландшафтное разнообразие широколиственных лесов, а следовательно, и
сохранить среду обитания бурзянских пчел. Расширение планируется на 36
тыс. га в западном направлении за счет неосвоенной территории на стыке
Мелеузовского, Ишимбайского и Бурзянского районов в междуречье Нугуша и
его правого притока Уряка, где нет населенных пунктов, животноводческих
объектов и лесозаготовок. Здесь сохранились экологически ценные
коренные старовозрастные леса, которых, к счастью, еще не коснулась
интенсивная хозяйственная деятельность человека. Если этот проект будет
одобрен, то площадь охраняемых мест обитания бурзянской пчелы вместе с
Национальным парком Башкирия и заказником Алтын Солок увеличится до 230
тыс. га.
Условия
существования пчел в бортях, их роль в экосистемах, предпочитаемость
жилищ, методы содержания бортевых пчелиных семей и снижения ущерба от
болезней, хищников и вредителей изучены пока недостаточно.
Принципиальным вопросом является определение численности семей в
естественных дуплах, для учета которых нет общепринятых методов. С
одной стороны, ведущие специалисты отмечают критическое состояние
генофонда башкирской пчелы: если не будут приняты кардинальные меры, мы
безвозвратно потеряем ценных местных пчел даже в тех районах, где они
еще сохранились. В Башкирии резко снижается продуктивность и отмечается
большая гибель, как следствие сплошной гибридизации [7]. В последние
годы появилась опасность исчезновения даже чистопородных бортевых пчел
заповедника «Шульган-Таш» под влиянием завезенных в
Башкирию других рас
[8]. С другой стороны, Агентство по пчеловодству Республики
Башкортостан сообщает о стабилизации и улучшении ситуации [9]. Таким
образом, реальных фактов, которые бы позволили сделать выводы, пока не
так много.
Известно,
что популяции бортевых пчел не могут существовать абсолютно
изолированно от пасечных популяций. Популяция бортевых пчел
немногочисленна и нуждается в постоянном пополнении семьями с пасек.
Поэтому окружающие пасеки играют значительную роль в обновлении
генофонда. Между бортевыми пчелами и пасечными идет постоянный обмен, и
эти процессы помогают сохранить популяцию. Доказательством этого
является ситуация в Южноуральском заповеднике Республики Башкортостан,
где с исчезновением деревень полностью исчезли бортевые пчелы и борти
остались пустыми.
Большое
значение для сохранения популяции пчел имеет корректная идентификация
подвидовой принадлежности. Нами ранее было показано, что в условиях
интенсивной гибридизации широко используемый морфометрический метод
идентификации подвидов пчелы не работает. Для решения этой проблемы
сотрудники лаборатории биохимии адаптивности насекомых в институте
биохимии и генетики УНЦ РАН разработали комплекс
молекулярно-генетических методов.
Для
гарантированного сохранения генофонда бурзянской популяции необходимо
исследовать пчел не только особо охраняемых территорий и Бурзянского
района, но и прилегающих районов, потому что до сих пор исследования
данной популяции проводились точечно и ограничивались территорией
заповедника Шульган-Таш. Генетические процессы внутри популяции и
степень гибридизации исследованы по узкому спектру
молекулярно-генетических методов. Кроме того, важно выявить границы
ареала данной популяции для разработки общей стратегии сохранения
бурзянской пчелы.
One
of the most interesting groups of insects are human bees - more than
16,000 modern species [1], but just kind of Apis mellifera L. was
widely used by man in the agricultural cultivation worldwide.
Extensive
natural range honeybee covers the whole of Africa, Europe and the
Middle East. The result was significant intraspecific differentiation
[2], at the moment it is generally accepted the existence of 25
subtypes. In Europe it is known the existence of 9 subspecies
A.mellifera, 8 of which lives in South and Central Europe. Only 1
subspecies Apis mellifera mellifera L. - European dark, dark forest,
she Central Russian bee - has mastered steppe and forest zones of
Northern Europe, which makes it very valuable for beekeeping in the
Nordic countries. More hundred years ago, this subspecies is served in
the vast territory of Eurasia along the northern border of the natural
range of the species. Evolution Ammellifera proceeded in severe
climatic conditions, resulting in a different subspecies became
exceptionally high winter hardiness, adaptability to the use of rapid
short with linden honey yield, resistance to nosema, Varroa,
askosferozu and honeydew toxicosis.
Unfortunately,
as a result of continuous heavy imports of bees from the south to the
northern regions there was a mass of bees hybridization. In Germany, a
massive import Amcarnica in the 1840s has led to almost complete
replacement of native bees Ammellifera [3]. In the Nordic countries and
the British Isles in most of the well instead of native bees bred
Ammellifera Amligustica and Amcarnica [4, 5, 6].
A
similar situation exists in Russia. The massive importation of bees in
the southern subspecies of the northern regions was organized in rock
during the zoning bees. In the development plan zoning rock bees in
1964-1975 gg. under the supervision of the Research Institute of
apiculture attended the scientific research and experimental
institutions, national and regional offices of beekeeping. As a result,
the mass importation of bees from southern areas in the forest and
steppe zones of Russia, the former area of the Central Russian bee
races were inhabited mostly by bees hybrid origin.
Bee
race of Central Ammellifera in Russia is represented by several local
populations preserved. One of them is the population of wild-hive bee
Burzyan preserved in the mountain forest zone of the Republic of
Bashkortostan. In the works G.A.Kozhevnikova (1929, 1931) emphasized
that this population of bees exceptionally clean through more than
1,000-year isolation. Interest in the Central Russian bees, especially
to its Burzyan and Verkhnekamsk ecotypes in recent years strengthened
significantly increased the demand for bees and queens of this
subspecies. The Government of the Republic of Belarus, and the district
administration Burzyansky Reserve Shulgan-Tash pay great attention to
the preservation Burzyan bee population. Most care is provided by
international organizations such as the World Wildlife Fund (WWF).
Within
the reserve is being breeding work, the district administration issued
a decree banning the importation of bees other subspecies in 1997
created reserve Altyn Solok. Currently planned expansion of the reserve
Shulgan-Tash, which will help keep the biological and landscape
diversity of deciduous forests, and hence to maintain the habitat
Burzyan bees. The expansion is planned for 36 th. Hectares to the west
by undeveloped territory at the junction Meleuzovsky, Ishimbaisky
Burzyansky areas and in the area between Nugush and its right tributary
Uryaka where there are no settlements, livestock and logging
facilities. Here are preserved ecologically valuable old-growth
indigenous forest, which, fortunately, has not yet touched the intense
human activities. If this project is approved, the area of protected
habitat Burzyan bee with Bashkiria National Park and Reserve Altyn
Solok increase to 230 thousand. Ha.
Conditions
for the existence of bees in the board, their role in the ecosystem,
preferred by dwellings, methods of detention wild-hive bee colonies and
reduce damage from disease, predators and pests studied long enough.
The fundamental question is to determine the number of families in
natural cavities, for which there is no generally accepted accounting
practices. On the one hand, leading experts say the critical state of
the Bashkir bee gene pool, if not taken drastic measures, we will
irrevocably lose valuable local bees, even in areas where they still
exist. In Bashkiria drastically reduced productivity, and there is
great destruction, as a result of continuous hybridization [7]. In
recent years, he appeared in danger of extinction, even purebred
wild-hive bee reserve "Shulgan-Tash" under the influence of imported
Bashkiria other races. [8] On the other hand, the Agency of the
Republic of Bashkortostan on beekeeping reports the stabilization and
improvement of the situation. [9] Thus, the real facts, which would
allow to draw conclusions until not so much.
It
is known that the population of wild-hive bee can not exist in
isolation from the apiary absolutely populations. Wild-hive bee
population is sparse and needs constant replenishment of families with
apiaries. So the surrounding apiaries play a significant role in the
renewal of the gene pool. In the wild-hive bees and beekeeping is a
constant exchange, and these processes help to keep the population.
Proof of this is the situation in the Republic of Bashkortostan
Yuzhnouralskaya Reserve, where the disappearance of villages completely
disappeared wild-hive bee and the board remained empty.
Of
great importance to maintain the population of bees is the correct
identification of the subspecies. We have previously shown that under
conditions of intense hybridization morphometric widely used method for
identifying subtypes bees work. To solve this problem, the laboratory
staff Biochemistry adaptability of insects at the Institute of
Biochemistry and Genetics, Ufa Science have developed a set of
molecular genetic techniques.
To
ensure preservation of the gene pool of a population Burzyan necessary
to investigate the bees not only protected areas and Burzyansky area,
but the surrounding areas, because until now the study of this
population were conducted spot and limited to the territory of the
reserve Shulgan-Tash. Genetic processes in the population studied and
the degree of hybridization on a narrow range of molecular genetic
methods. In addition, it is important to identify the boundaries of the
area of a given population to develop a common strategy of
preservation Burzyan bees. |
028.Поскряков
А.В., Ильясов Р.А. Бурзянская популяция темной лесной пчелы Apis
mellifera mellifera L. и перспективы ее сохранения. Материалы
международной конференции "Пчеловодство - XXI века". Москва. 2008.
С.300-301.
Подвид
Apis mellifera mellifera L. (темная лесная пчела – в Европе,
или
среднерусская - в России) занимал обширную территорию от
Британских
островов до Урала, вдоль северной границы естественного видового
ареала. Эволюция его проходила в суровых условиях, и он приобрел
свойства, обеспечивающие его преимущество перед другими подвидами пчел.
К сожалению, в течение 20 века ареал сильно сократился в результате
интенсивной гибридизации, но предполагалось, что локальные популяции
существуют, однако их соответствие чистопородности было под вопросом.
Считается,
что в настоящее время в Западной Европе практически
невозможно найти
негибридизованные семьи A.m.mellifera. В нашей стране A.m.mellifera
также была подвержена интенсивной гибридизации в результате завоза пчел
из южных регионов страны. Однако предполагалось, что в отдельных местах
еще могли сохраниться популяции A.m.mellifera. Самая известная из них
–
бурзянская популяция бортевых пчел на территории Республики
Башкортостан.
Еще в работах Г.А.Кожевникова (1929, 1931)
подчеркивалось, что эта популяция исключительно чистая за счет более
чем 1000-летней изоляции.
Условия существования пчел в бортях, их
роль в экосистемах, предпочитаемость жилищ, методы содержания бортевых
пчелиных семей и снижения ущерба от болезней, хищников и вредителей
изучены пока недостаточно. Принципиальным вопросом является определение
численности семей в естественных дуплах, для учета которых нет
общепринятых методов. С одной стороны, ведущие специалисты отмечают
критическое состояние генофонда башкирской пчелы: если не будут приняты
кардинальные меры, мы безвозвратно потеряем ценных местных пчел даже в
тех районах, где они еще сохранились. В Башкирии резко снижается
продуктивность и отмечается большая гибель, как следствие сплошной
гибридизации (Шакиров, 1966, 1987, 1988). В последние годы появилась
опасность исчезновения даже чистопородных бортевых пчел заповедника
«Шульган-Таш» под влиянием завезенных в Башкирию
других рас (Шафиков,
1978). С другой стороны Агентство по пчеловодству Республики
Башкортостан сообщает о стабилизации и улучшении ситуации
(Шагимухаметов, 1999). Таким образом, реальных фактов, которые бы
позволили сделать выводы, пока не так много.
Кроме того, бортевые
пчелы не могут существовать абсолютно изолированно. Так как сама
популяция бортевых пчел небольшая, она нуждается в постоянном
пополнении за счет пасечных пчел. Поэтому окружающие пасеки играют
большую роль. Между бортевыми пчелами и пасечными идет постоянный
обмен, и эти процессы помогают сохранить популяцию. Доказательством
этого является опыт Южноуральского заповедника (Республика
Башкортостан), где с исчезновением деревень полностью исчезли и
бортевые пчелы, хотя сами борти сохранились.
Правительство РБ,
администрации Бурзянского района и заповедника Шульган-Таш уделяют
большое внимание сохранению бурзянской популяции. Большую помощь
оказывают также международные организации, в частности Всемирный фонд
охраны дикой природы (WWF). На территории заповедника ведется племенная
работа, администрацией района издан указ о запрете на ввоз пчел других
подвидов, в 1997 году создан заказник Алтын солок. В
настоящее время
намечается расширение территории заповедника Шульган-Таш, что поможет
сохранить биологическое и ландшафтное разнообразие широколиственных
лесов, а, следовательно, и сохранить среду обитания бурзянских пчел.
Расширение планируется на 36 тыс. га в западном направлении за счет
неосвоенной территории на стыке Мелеузовского, Ишимбайского и
Бурзянского районов в междуречье Нугуша и его правого притока Уряка,
где нет населенных пунктов, животноводческих объектов и лесозаготовок.
Здесь сохранились экологически ценные коренные старовозрастные леса,
которых, к счастью, еще не коснулась интенсивная хозяйственная
деятельность человека. Если этот проект будет одобрен, то площадь
охраняемых мест обитания бурзянской пчелы вместе с Национальными
парками "Башкирия" и Алтын Солок увеличится до 230 тыс. га.
Кроме
того, большое значение для сохранения популяции имеет корректная
идентификация подвида. Нами ранее было показано, что в условиях
интенсивной гибридизации широко используемый морфометрический метод
идентификации подвидов пчелы не работает. Для решения этой проблемы мы
разработали комплекс молекулярно-генетических методов.
Тем не менее,
для гарантированного сохранения генофонда бурзянской популяции
необходимо охватить не только особо охраняемые территории, а всю
территорию Бурзянского района, потому что до сих пор
исследования
данной популяции проводились точечно и ограничивались территорией
заповедника Шульган-Таш. Генетические процессы внутри популяции и
степень гибридизации исследованы по узкому спектру
молекулярно-генетических методов. Кроме того, важно выявить границы
ареала данной популяции для разработки общей стратегии
сохранения
бурзянской пчелы.
The subspecies Apis mellifera mellifera L. (dark
forest bee - in Europe, or the Mid - in Russia) occupied a vast
territory from the British Isles to the Urals, along the northern
border of the natural habitat of the species. Evolution it was held in
harsh conditions, and it has acquired properties that provide it an
edge over other subspecies of bees. Unfortunately, during the 20th
century area of greatly reduced as a result of intensive
hybridization, but it was assumed that the local population there, but
their correspondence was a pure breed in question.
It is estimated
that currently in Western Europe is almost impossible to find a
non-hybridized family Ammellifera. In our country Ammellifera was also
subject to intense hybridization resulting in the importation of bees
from the southern regions of the country. However, it was assumed that
in some places could still keep the population Ammellifera. The most
famous of them - Burzyan population of wild-hive bee on the territory
of the Republic of Bashkortostan.
Still in the works
G.A.Kozhevnikova (1929, 1931) emphasized that this population extremely
clean through more than 1,000-year isolation.
Conditions for the
existence of bees in the board, their role in the ecosystem, preferred
by dwellings, methods of detention wild-hive bee colonies and reduce
damage from disease, predators and pests studied long enough. The
fundamental question is to determine the number of families in natural
cavities, for which there is no generally accepted accounting
practices. On the one hand, leading experts say the critical state of
the Bashkir bee gene pool, if not taken drastic measures, we will
irrevocably lose valuable local bees, even in areas where they still
exist. In Bashkiria drastically reduced productivity, and there is
great destruction, as a result of continuous hybridization (Shakirov,
1966, 1987, 1988). In recent years, he appeared in danger of
extinction, even purebred wild-hive bee reserve "Shulgan-Tash" under
the influence of imported Bashkiria other races (Shafiq 1978). On the
other hand the Agency on beekeeping RB reports the stabilization and
improvement of the situation (Shagimuhametov, 1999). Thus, the real
facts, which would allow to draw conclusions until not so much.
In
addition, wild-hive bees can not completely exist in isolation. Since
the very small population of wild-hive of bees, it needs constant
replenishment due apiary bees. So the surrounding apiaries play a big
role. In the wild-hive bees and beekeeping is a constant exchange, and
these processes help to keep the population. Proof of this is the
experience of South Ural Reserve (Republic of Bashkortostan) where the
disappearance of the villages have completely disappeared and wild-hive
bee, though they remained aboard.
The Government of the Republic of
Belarus, and the district administration Burzyansky Reserve
Shulgan-Tash pay great attention to the preservation Burzyan
population. Most care is provided by international organizations such
as the World Wildlife Fund (WWF). Within the reserve is being breeding
work, the district administration issued a decree banning the
importation of bees other subspecies in 1997 created reserve Altyn
Solok. Currently planned expansion of the reserve Shulgan-Tash, which
will help keep the biological and landscape diversity of deciduous
forests, and, consequently, save the environment Burzyan bees. The
expansion is planned for 36 th. Hectares to the west by undeveloped
territory at the junction Meleuzovsky, Ishimbaisky Burzyansky areas and
in the area between Nugush and its right tributary Uryaka where there
are no settlements, livestock and logging facilities. Here are
preserved ecologically valuable old-growth indigenous forest, which,
fortunately, has not yet touched the intense human activities. If this
project is approved, the area of protected habitat Burzyan bee along
with the national park "Bashkiria" Altyn Solok and will increase to 230
thousand. Ha.
In addition, of great importance to maintain the
population has the correct identification of the subspecies. We have
previously shown that under conditions of intense hybridization
morphometric widely used method for identifying subtypes bees work. To
solve this problem, we developed a set of molecular genetic methods.
However,
to guarantee the preservation of the gene pool of a population Burzyan
need to cover not only the protected areas, and the entire territory of
Burzyansky area, because until now carried out studies of this
population point and limited to the territory of the reserve
Shulgan-Tash. Genetic processes in the population studied and the
degree of hybridization on a narrow range of molecular genetic methods.
In addition, it is important to identify the boundaries of the area of
a given population to develop a common strategy of preservation
Burzyan bees. |
027.
Ильясов
Р.А., Поскряков А.В., Николенко А.Г. Пчелы среднерусской расы Apis
mellifera mellifera L. на Урале. Вестник Оренбургского государственного
университета. № 75. Оренбург. 2007. С. 146-148.
Пчелы
среднерусской расы Apis mellifera mellifera L. на Урале (Honey bees of
Apis mellifera mellifera L. in the Central Urals) Приводятся данные о
популяции пчелы среднерусской расы Apis mellifera mellifera L. на
Урале. В диком виде этот подвид пчелы сохранился только в бортях в
горно-лесной зоне Южного Урала. В Республике Башкортостан создан
заповедник по охране бортевых пчел. Выявлены основные места обитания
пчел среднерусской расы на Урале. В Институте биохимии и генетики
лабораторией биохимии адаптивности насекомых под руководством
профессора А.Г. Николенко разработан эффективный метод генетической
идентификации пчел подвида A.m.mellifera на Урале на основе изучения
полиморфизма генов ядерной и митохондриальной ДНК, а также
биохимического анализа продуктов экспрессии генов, ответственных за его
иммунитет и устойчивость. The data on the population of bees Central
Russian race Apis mellifera mellifera L. in the Urals. In the wild,
this subspecies of bees preserved only in the board in the mountain
forest zone of the Southern Urals. In the Republic of Bashkortostan
reserve has been established for the protection of wild-hive of bees.
The basic habitat of Central bees race in the Urals. At the Institute
of Biochemistry and Genetics Laboratory Biochemistry adaptability
insects under the direction of Professor AG below Kolenko developed an
effective method of genetic identification bee subspecies Ammellifera
the Urals-based study polymorphism of nuclear and mitochondrial DNA and
biochemical Analysis of expression products of genes responsible the
immune system and its stability. Publication Name: Ilyasov R.A.,
Poskryakov A.V. Nikolenko A.G. Honey bees of Apis mellifera mellifera
L. in the Central Urals. Bulletin of the Orenburg State University. V.
75. 2007, P. 146-148. |
026.
Ильясов Р.А.,
Поскряков А.В., Николенко А.Г., Комиссар А.Д. Украинские пчелы Apis
mellifera sossimai - отдельный подвид или северо-западно
причерноморский экотип пчел Apis mellifera macedonica?. Сборник статей
"Апидология и пчеловодство". Выпуск 2. Ижевск. 2007. С 12-20.
Известно,
что украинская медоносная пчела подвида Apis mellifera sossimai Engel,
1999 (старое неверное название Apis mellifera acervorum Scorikov),
аборигенна для большей части Украины и некоторых юго-западных регионов
России. Также известно, что генотип этого подвида пчел является
составляющим генофонда пчел дальневосточной популяции, имеющих, как
известно, гибридное происхождение. К сожалению, еще не была определена
граница распространения A.m.sossimai на Западе. В Румынии считают, что
там обитает уникальный аборигенный подвид медоносной пчелы - Apis
mellifera carpatica Foti et al., 1965, ареал которого - долины
карпатских гор. Восточная же граница ареала A.m.carpatica до сих пор не
определена.
Существует
несколько гипотез о происхождении украинских пчел - от простого
утверждения, что они являются южной ветвью Apis mellifera mellifera L.
(Таранов, 1987) и заявления, что они являются видоизмененной популяцией
Apis mellifera carnica Pollmann, 1879 (Губин, 1977) до более сложного -
результат бессистемной гибридизации подвидов A.m.mellifera и
A.m.carpatica и дальнейшего длительного естественного отбора в условиях
степей Украины (Билаш, Кривцов, 1991).
F.Ruttner
(1988) на основе морфометрических исследований показал, что пчелы
северной Греции могут быть выделены в отдельный подвид Apis mellifera
macedonica Ruttner, 1987. Кроме того F.Ruttner (1988) показал, что
пчелы на территории Болгарии и Румунии также относятся к подвиду
A.m.macedonica, хотя в каждой из этих стран считают, что у них свой
аборигенный подвид пчелы, а не A.m.macedonica. Из Украины через НИИ
пчеловодства России (г.Рыбное) F.Ruttner (1988) получил только две
матки и определил, что их также можно отнести к A.m.macedonica.
Конкретное место происхождения этих маток осталось неизвестным. Сами
результаты F.Ruttner (1988), описанные только в его монографии 1988
года очень долго оставались неизвестными апидологам Украины и России.
Поскольку у F.Ruttner (1988) не было достаточного количества материала
с Украины, он не включил ее в карту распространения A.m.macedonica, но
его данные можно рассматривать как нечетко сформированную гипотезу о
принадлежности украинских пчел к подвиду A.m.macedonica.
Сопоставление
морфологических характеристик болгарских, румынских и украинских пчел
позволило А.Д.Комиссару (2003) утверждать, что это может быть один
подвид медоносной пчелы, всего лишь называемый по-разному в разных
странах, поскольку при проведении исследований ученые из этих стран
часто ограничивались только границами своей страны.
Впоследствии
несколько десятков образцов украинских пчел было проанализировано с
использованием дискриминантного компьютерного анализа 30 параметров
жилкования крыльев в Чехии в Институте пчеловодства (Чермак, Комиссар,
неопубликованные результаты). Первоначальной целью этих исследований
было создание стандарта украинских пчел по жилкованию крыльев, который
позволил бы быстро отличать их от пчел других подвидов и такой
временный стандарт даже был создан. Однако оказалось, что большинство
исследованных образцов украинских пчел по данному признаку можно было
отнести к подвиду A.m.macedonica. Таким образом, идентификацию
украинских пчел, как оказалось, можно проводить по существующему
стандарту A.m.macedonica. Эти данные подтвердили гипотезу F.Ruttner
(1988) о том, что украинские пчелы являются субпопуляцией единой
популяции A.m.macedonica, распространенной на территории нескольких
стран восточной Европы. Однако существующее мнение о том, что
украинские пчелы - отдельный подвид пчел, очень устойчиво. Даже в
международной номенклатуре украинские пчелы приняты за отдельный подвид
A.m.sossimai Engel, 1999. Для уточнения действительного
таксономического статуса украинских пчел необходимо провести
дополнительные исследования с использованием молекулярно-генетических
методов.
Мы
поставили цель – показать, какой из подвидов европейских пчел
наиболее
генетически близок к украинским пчелам на основе сравнения нуклеотидных
последовательностей фрагмента гена ND2 митохондриальной ДНК (мтДНК)
украинских пчел A.m.sossimai, с A.m.macedonica из Греции, A.m.carnica
из Германии и Австрии, Apis mellifera ligustica Spinola, 1806 из
Италии, A.m.mellifera из республики Башкортостан.
При
работе с украинскими пчелами существовала большая опасность того, что в
качестве образцов украинских пчел могли попасть гибридные и тогда бы
наши выводы могли быть неверными. Действительно, проведенный в Чехии
компьютерный анализ жилкования крыльев пчел из племенных семей лучшего
питомника Института пчеловодства Украины показал, что большая часть из
них – это гибридные пчелы (Комиссар, 2006). Поэтому для
анализа мы
взяли пчел из личной пасеки А.Д.Комиссара, где содержались племенные
чистые линии украинских пчел, отобранные на основании анализов по
жилкованию крыльев в Чехии. Следует отметить, что на основании анализов
по жилкованию крыльев были отбракованы около 50% семей, полученных с
пасеки Л.Егошина в Сумской области.
В
работе нами была определена нуклеотидная последовательность фрагмента
гена ND2 мтДНК трех образцов пчел из Украины (пасека А.Д.Комиссара
около г. Киева) (номера в международных генбанках EMBL, NCBI, DDBJ:
DQ361088, DQ361089, DQ361090), трех образцов пчел из России (Республика
Башкортостан, Бурзянский район) с пасеки Капова-Пещера (DQ181612), с
пасеки Коран-Елга (DQ181613), и из бортей Государственного природного
заповедника «Шульган-Таш» (DQ181611) (табл. 1).
Определение
нуклеотидной последовательности фрагмента гена ND2 мтДНК проводили на
автоматическом секвенаторе ABI Prism 310 Genetic Analyser (PE Applied
Biosystems, USA) с использованием набора для флюоресцентного мечения
DYEnamicTMET согласно протоколу фирмы производителя (Amersham Pharmacia
Biotech DYEnamic ET Terminator Cycle Sequencing Kit).
В
сравнении были использованы нуклеотидные последовательности фрагмента
гена ND2 мтДНК рабочих особей пчел из Греции, Германии Австрии и Италии
(всего 18 образцов пчел) (табл. 1). Образцы подвида A.m.mellifera -
представители эволюционной ветви М - в данном сравнении были
использованы в качестве аутгруппы для укоренения полученной
филогенетической схемы. Представители подвидов A.m.ligustica и
A.m.carnica были использованы в сравнении для того, чтобы выявить
возможную гибридизацию украинских пчел с A.m.ligustica и A.m.carnica в
связи с их большой популярностью среди пчеловодов Восточной и Западной
Европы.
Известно,
что фрагмент гена ND2 мтДНК вариабелен по нуклеотидному составу (Arias,
Sheppard, 1996). Анализ нуклеотидной последовательности фрагмента гена
ND2 мтДНК размером 574 п.н. показал однонуклеотидные замены в 10
позициях, из которых 9 были транзициями и 1 трансверсией (табл. 2).
Отсчет нуклеотидов проводился относительно нуклеотидной
последовательности полной митохондриальной ДНК подвида медоносной пчелы
A.m.ligustica (NC 001566) просеквенированной R.H.Crozier и Y.C.Crozier
(1993) размером 16343 п.н.
На
основе сравнения нуклеотидных последовательностей фрагмента гена ND2
мтДНК пчел с использованием программы MEGA 3.1 (Kumar et al., 2004) и
дальнейшего расчета средних генетических расстояний между образцами
было показано тесное генетическое родство пчел из Украины с пасеки
А.Д.Комиссара и пчел A.m.macedonica из Греции, где средние генетические
расстояния между образцами A.m.macedonica и A.m.sossimai были равны
0,0000 (табл. 3).
Таким
образом, наиболее генетически отдаленными от украинских пчел оказались
пчелы A.m.mellifera из республики Башкортостан России (уникальной
сохранившейся аборигенной популяции A.m.mellifera), что вполне логично,
так как A.m.macedonica, A.m.carnica, A.m.ligustica –
представители
эволюционной ветви С (Ruttner, 1988), а A.m.mellifera –
эволюционной
ветви М.
На
основе генетических дистанций с использованием программы MEGA 3.1 и
метода кластеризации ближайшего соседа (Saitou and Nei, 1987) была
построена филогенетическая схема (рис. 1), на которой можно наблюдать
генетическое родство между подвидами пчел. Все образцы A.m.macedonica и
A.m.sossimai объединились в одну группу, что говорит о тесном
генетическом родстве украинских и греческих пчел. В другую группу
объединились пчелы A.m.carnica Германии и Австрии, которые наиболее
близки A.m.macedonica. Представители A.m.mellifera республики
Башкортостан оказались наиболее отдаленными от A.m.macedonica и,
соответственно, от A.m.sossimai.
Таким
образом, нет никаких оснований говорить о том, что украинские пчелы
–
это южная ветвь среднерусских пчел A.m.mellifera или результат
бессистемной гибридизации A.m.mellifera с A.m.carpatica. Но у нас есть
все основания утверждать, что украинские пчелы A.m.sossimai являются
субпопуляцией подвида A.m.macedonica.
Образцы
пчел A.m.ligustica Италии разделились на две группы, одна из которых
была очень близка к A.m.macedonica, а другая находилась на заметном
отдалении. Согласно результатам исследований морфометрических
характеристик A.m.ligustica Италии обладал большим сходством с
A.m.carnica Австрии и Югославии (Ruttner, 1988). Мы полагаем, что,
возможно, часть популяций A.m.ligustica Италии была гибридизована с
A.m.mellifera Франции, что также подтверждалось в работе P.Franck et
al. (2000) на основе изучения полиморфизма межгенного локуса COI-COII
мтДНК.
Выводы:
1.
Исходя из сравнительного анализа нуклеотидных последовательностей
фрагмента гена ND2 мтДНК можно утверждать, что исследованные образцы
украинских пчел относятся к подвиду A.m.macedonica.
2.
Полученные результаты позволяют исключить предположения о том, что
украинские пчелы являются южной ветвью среднерусских пчел A.m.mellifera
или результатом ее бессистемной гибридизации с карпатскими пчелами
A.m.carpatica.
3.
На основе оценки генетических расстояний можно утверждать, что
краинские A.m.carnica и македонские A.m.macedonica пчелы по отношению
друг к другу являются подвидами, а не экотипами одного подвида, что
отвергает гипотезу В.Губина (1977) о том, что украинские пчелы могут
быть одной из популяций A.m.carnica.
4.
Полученные данные являются еще одним подтверждением предположения
F.Ruttner (1988) о возможной принадлежности украинских пчел к
A.m.macedonica. Существует много оснований предполагать, что украинские
пчелы A.m.sossimai Engel 1999 не отдельный подвид, а украинская
популяция A.m.macedonica с возможным названием Apis mellifera
macedonica var. ukrainica (предложение А.Д.Комиссара, 2005).
It
is known that Ukrainian honeybee subspecies Apis mellifera sossimai
Engel, 1999 (old Incorrect Apis mellifera acervorum Scorikov),
indigenous to most of Ukraine and some south-western regions of Russia.
It is also known that the genotype of this subspecies of bees is a
component of the gene pool of the population of the Far Eastern bees,
have been known to hybrid origin. Unfortunately, there has not been
determined Amsossimai border of the West. In Romania, believe that
there resides a unique subspecies of native honey bee - Apis mellifera
carpatica Foti et al., 1965, the area of which - the valley of the
Carpathian Mountains. The eastern boundary of the range Amcarpatica has
not yet been determined.
There
are several hypotheses about the origin of Ukrainian bees - from the
simple statement that they are the southern branch of the Apis
mellifera mellifera L. (Taranov 1987) and the statements that they are
modified population of Apis mellifera carnica Pollmann, 1879 (Gubin,
1977) to the more complex - the result of haphazard and hybridization
subspecies Ammellifera Amcarpatica and further extended natural
selection in terms of the steppes of Ukraine (Bilash, Krivtsov, 1991).
F.Ruttner
(1988), based on morphometric studies have shown that bees northern
Greece can be allocated to a separate subspecies of Apis mellifera
macedonica Ruttner, 1987. In addition F.Ruttner (1988) showed that the
bees on the territory of Bulgaria and Rumunii also belong to the
subspecies Ammacedonica, although in each of these countries consider
that they have their own subspecies of native bees, not Ammacedonica.
From Ukraine through Russian Research Institute of Apiculture
(g.Rybnoe) F.Ruttner (1988) I received only two of the uterus and
determined that they can also be attributed to Ammacedonica. The
specific place of origin of the queens remained unknown. The results
themselves F.Ruttner (1988) described only in his monograph in 1988 for
a long time remained unknown apidologam Ukraine and Russia. Since
F.Ruttner (1988) did not have enough material from the Ukraine, he did
not include it in the map of distribution Ammacedonica, but data can be
regarded as a clearly formed the hypothesis of belonging to the
Ukrainian bee subspecies Ammacedonica.
Comparison
of the morphological characteristics of the Bulgarian, Romanian and
Ukrainian bees allowed A.D.Komissaru (2003) argue that this may be one
of the honey bee subspecies, just called differently in different
countries, because the research scientists from these countries are
often limited to only the borders of their country.
Subsequently,
a few dozen specimens Ukrainian bees were analyzed using discriminant
analysis computer 30 parameters venation wings in the Czech Republic at
the Institute of beekeeping (Cermak, Commissioner, unpublished
results). The initial aim of this research was to create a standard
Ukrainian bees wing venation that would quickly distinguish them from
other subspecies of bees, and even a temporary standard was created.
However, it appeared that most of the samples Ukrainian bees on this
basis can be attributed to the subspecies Ammacedonica. Thus, the
identification of the Ukrainian bees, as it turns out, can be carried
out on the existing standard Ammacedonica. These data support the
hypothesis F.Ruttner (1988) that the Ukrainian bees are a subset of a
single population Ammacedonica, spread across several countries in
eastern Europe. However, the existing opinion that the Ukrainian bee -
separate subspecies of bees, it is very stable. Even in the
international nomenclature Ukrainian bee taken as a separate subspecies
Amsossimai Engel, 1999. To clarify the actual taxonomic status of
Ukrainian bees need to conduct additional studies using molecular
genetic techniques.
We
set a goal - to show which of the subspecies of European bees most
genetically similar to Ukrainian bees by comparing the nucleotide
sequences of the gene fragment ND2 mitochondrial DNA (mtDNA) Ukrainian
bees Amsossimai, with Ammacedonica from Greece, Amcarnica from Germany
and Austria, Apis mellifera ligustica Spinola, 1806 from Italy,
Ammellifera of the Republic of Bashkortostan.
When
working with the Ukrainian bees there is great danger that as samples
Ukrainian bees could get hybrid and then it would be our conclusions
might be incorrect. Indeed, in the Czech Republic carried out a
computer analysis of the venation of the wings of bees from tribal
families better nursery Apiculture Institute showed that most of them -
a hybrid bee (Commissioner, 2006). Therefore, we have taken for
analysis of individual bee apiary A.D.Komissara where tribal kept clean
lines Ukrainian bees, selected on the basis of analyzes of wing
venation in the Czech Republic. It should be noted that based on the
analysis of wing venation were culled about 50% of families received
from the apiary L.Egoshina in Sumy region.
In
this paper we determined the nucleotide sequence of a gene fragment ND2
mtDNA three samples of bees from Ukraine (apiary A.D.Komissara around
Kiev) (numbers in international genebanks EMBL, NCBI, DDBJ: DQ361088,
DQ361089, DQ361090), three samples of bees Russia (Bashkortostan,
Burzyan district) from the apiary Kapova-Cave (DQ181612), from the
apiary Quran-Elga (DQ181613), and of the board of the State Natural
Reserve "Shulgan-Tash» (DQ181611) (Table. 1).
Determination
of the nucleotide sequence of the gene fragment ND2 mtDNA performed on
an automatic sequencer ABI Prism 310 Genetic Analyser (PE Applied
Biosystems, USA) using a kit for the fluorescent labeling DYEnamicTMET
according to the protocol of the manufacturer (Amersham Pharmacia
Biotech DYEnamic ET Terminator Cycle Sequencing Kit).
Compared
were used nucleotide sequences of mtDNA gene fragment ND2 bees working
individuals from Greece, Germany, Austria and Italy (all 18 samples of
bees) (Table. 1). Samples subspecies Ammellifera - M representatives
evolutionary branch - in this comparison were used as outgroup to root
the resulting phylogenetic schemes. Representatives subspecies
Amligustica and Amcarnica were used for comparison in order to identify
a possible hybridization Ukrainian bees Amligustica Amcarnica and due
to their great popularity among beekeepers in Eastern and Western
Europe.
It
is known that a gene fragment ND2 mtDNA is variable in nucleotide
composition (Arias, Sheppard, 1996). Nucleotide sequence analysis of
mtDNA ND2 gene fragment size 574 bp He showed single nucleotide
substitutions in positions 10, 9 of which were transitions and
transversions 1 (tab. 2). Counting was carried out with respect to
nucleotides of the nucleotide sequence of full mitochondrial DNA
subspecies of honeybee Amligustica (NC 001566) and sequenced RHCrozier
YCCrozier (1993) the size of 16343 bp
Based
on a comparison of the nucleotide sequences of mtDNA gene fragment ND2
bees using the program MEGA 3.1 (Kumar et al., 2004) and further
calculation of the average genetic distance between samples was shown a
close genetic relationship of bees from Ukraine to the apiary and bee
A.D.Komissara Ammacedonica from Greece, where the average genetic
distances between samples and Ammacedonica Amsossimai were equal to
0.0000 (Table. 3).
Thus,
the most genetically distant from the Ukrainian bee bee appeared
Ammellifera of Bashkortostan Republic of Russia (unique surviving
indigenous populations Ammellifera), which is quite logical, since
Ammacedonica, Amcarnica, Amligustica - representatives of evolutionary
branches from (Ruttner, 1988) and Ammellifera - evolutionary branch M.
On
the basis of genetic distances using the program MEGA 3.1 and the
nearest neighbor clustering method (Saitou and Nei, 1987) was
constructed phylogenetic diagram (Fig. 1), which can be observed
genetic relatedness between subspecies of bees. All samples
Ammacedonica and Amsossimai merged into one group, which suggests a
close genetic relationship Ukrainian and Greek bees. In another group
of bees Amcarnica united Germany and Austria, which are closest
Ammacedonica. Representatives of the Republic of Bashkortostan
Ammellifera were the most distant from Ammacedonica and, accordingly,
from Amsossimai.
Thus,
there is no reason to say that the Ukrainian bee - is the southern
branch of the Central Russian bees Ammellifera or haphazard result of
hybridization with Ammellifera Amcarpatica. But we have every reason to
believe that Ukrainian are a subset of bees Amsossimai subspecies
Ammacedonica.
Samples
of bees Amligustica Italy were divided into two groups, one of which
was very close to Ammacedonica, and the other was on a marked distance.
According to the research of morphometric characteristics Amligustica
Italy have much in common with Amcarnica Austria and Yugoslavia
(Ruttner, 1988). We believe that, perhaps, part of the population
Amligustica Italy was hybridized with Ammellifera France, which is also
confirmed in the P.Franck et al. (2000), based on the study of
polymorphism of the intergenic locus COI-COII mtDNA.
Findings:
1.
On the basis of a comparative analysis of the nucleotide sequences of
mtDNA gene fragment ND2 can be argued that the samples studied
Ukrainian bee subspecies are Ammacedonica.
2.
The results allow to exclude the assumption that Ukrainian bees are the
southern branch of the Central Russian bees Ammellifera or results of
unsystematic hybridization with Carpathian bees Amcarpatica.
3.
On the basis of the assessment of genetic distances can be argued that
the Krajina Amcarnica and Macedonian Ammacedonica bee in relation to
each other is a subspecies, not ecotypes of subspecies, which rejects
the hypothesis V.Gubina (1977) that the Ukrainian bees can be one of
the populations Amcarnica.
4.
The findings are further confirmation of the assumptions F.Ruttner
(1988) about a possible affiliation to the Ukrainian bees Ammacedonica.
There are many reasons to believe that the Ukrainian bee Amsossimai
Engel 1999 not a separate subspecies, and the Ukrainian population
Ammacedonica with possible name Apis mellifera macedonica var.
ukrainica (proposal A.D.Komissara, 2005). |
025.
Ильясов
Р.А., Поскряков А.В., Колбина Л.М., Николенко А.Г. Сохранение Apis
mellifera m. в Удмуртской республике. Сборник статей "Апидология и
пчеловодство". Выпуск 2. Ижевск. 2007. С 10-12.
Пчеловодство
— одно из древнейших занятий человека. Известно, что в России
им
занимались с XI века славяне, башкиры, мордвинцы, марийцы, удмурты,
которые жили по берегам Вол и, Оки, Клязьмы (Суворин, Болсу- новский,
1990). Аборигенными пчелами для Поволжья были среднерусские пчелы, то
есть пчелы подвида Apis melhfera mellifera L. Однако за последние 100
лет во многих регионах России произошла гибридизация подвидов пчел.
Начиная с 20-х годов XX века в большом количестве стали завозить в
Поволжье пчел из южных регионов. До 70-х годов гибридизация шла в
основном за счет завоза в северные районы кавказских пчел
A.m.caucasica, а позже - карпатских пчел (Черевко, 2005). По данным
исследований морфометрических признаков медоносных пчел шести районов
Удмуртской Республики только 12,3% пчел можно отнести к среднерусской
породе. Однако авторы сами признают малую эффективность
морфометрических методов в определении подвидовой принадлежности пчел в
условиях интенсивной гибридизации (Колбина, Непейвода, 2005; 2006).
В
1994 году на основе данных многолетнего сравнительного изучения и
производственного испытания подвидов пчел в различных зонах России
коллегией Министерства сельского хозяйства и продовольствия был принят
новый вариант районирования пород пчел в регионах РФ, согласно которому
для природно-климатических условий Удмуртии был рекомендован подвид
A.m.mellifera, или среднерусская порода пчел. Таким образом,
восстановление популяции A.m.mellifera на данный момент стало основной
задачей пчеловодства Удмуртии. Первый и основной шаг в восстановлении
популяций A.m.mellifera в Удмуртской Республике - поиск сохранившихся
популяций с использованием более эффективных методов идентификации
подвидов по сравнению с морфометрическими. Известно, что
молекулярно-генетические методы способны различать подвиды пчел в
условиях интенсивной гибридизации, что и было нами использовано.
Для
определения подвидовой принадлежности пчел был использован полиморфизм
межгенного локуса COI-COII митохондриальной ДНК (мтДНК), комбинация PQQ
которого характеризует происхождение пчел от A.m.mellifera по
материнской линии (Ильясов и др., 2006). Всего было проанализировано 69
семей пчел с 11 пасек 6 районов Удмуртии.
Результаты
показали, что на большинстве пасек преобладали семьи, имеющие
происхождение от A.m.mellifera. Частота комбинации PQQ была очень
высокой (>0,95) на некоторых пасеках Камбарского, Глазовского.
Можгинского, Завьяловского. а в Мало-Пургинском районе частота комби-
миии PQQ оказалась довольно низкой (<0,70). На пасеках с. Шаркан
Шар- шмехого района, с. Постол Завьяловского района и д. Вишур
МалоПургинского районов наблюдалась довольно низкая частота комбинации
PQQ (<0,70), что свидетельствует о завозе пчел южных подвидов
(табл.
1).
К
сожалению, анализ проводился на очень ограниченном количестве образцов.
Для получения более объективных данных планируется увеличить объем
выборки из локальных популяций, а также расширить число генетических
маркеров. Наибольший интерес для нас представляют северные районы
Удмуртии, где имеются большие шансы на сохранение популяций A
m.mellifera, благодаря более жесткому естественному отбору в северных
условиях. Так, например, сохранилась уникальная популяция A.m.mellifcra
в Красновишерском районе Пермского края.
Beekeeping
- one of the oldest human activities. We know that in Russia, they were
engaged in the XI century the Slavs, Bashkirs, Mordvintsev, Mari,
Udmurts, who lived along the banks and Wall, Oka, Klyazma (Suvorin
Bolsu--ray, 1990). Aboriginal bees to the Volga region were Central
Russian bees, ie bee subspecies Apis melhfera mellifera L. However,
over the last 100 years in many regions of Russia there was a
hybridization of subspecies of bees. Since the 20-ies of XX century in
large quantities were imported in the Volga region of bees from
southern regions. Until the 70s hybridization was mainly due to the
delivery to the northern areas of the Caucasian bees Amcaucasica, and
later - the Carpathian bees (Cherevko, 2005). According to the research
of morphometric characters of honeybees six districts of the Udmurt
Republic only 12.3% of the bees can be attributed to the Central
Russian breed. However, the authors themselves admit low efficiency
morphometric methods in determining the subspecies of bees in the
conditions of intensive hybridization (Kolbina, Nepeivoda, 2005; 2006).
In
1994, on the basis of long-term comparative study and testing of
subspecies of bees in different regions of Russia Board of the Ministry
of Agriculture adopted a new version of the zoning species of bees in
the regions of the Russian Federation, according to which for the
climatic conditions of Udmurtia was recommended subspecies Ammellifera,
or Central Russian breed of bees. Thus, the recovery of populations
Ammellifera at the moment has become the main task of beekeeping
Udmurtia. The first and basic step in restoring populations Ammellifera
in the Udmurt Republic - find the surviving population with the use of
more effective methods of identifying subspecies compared with the
morphometric. It is known that the molecular-genetic methods are able
to distinguish subtypes of bees in the conditions of intensive
hybridization, which was used by us.
To
determine the subspecies of bees was used polymorphism of the
intergenic locus COI-COII mitochondrial DNA (mtDNA), which is
characterized by a combination of PQQ origin of bees from Ammellifera
maternal (Ilyasov et al., 2006). There were analyzed 69 bee colonies
from 11 apiaries 6 districts of Udmurtia.
The
results showed that in most apiaries dominated family, originating from
Ammellifera. Frequency combination PQQ was very high (> 0.95) in
some apiaries Kambarka, Glazov. Mozhginsky, Zavyalovsky. and in the
area of Little Purginskom frequency combinations miii PQQ was quite
low (<0.70). On apiaries with. Sharkan Shar shmehogo district
with.
Postol Zavyalovsky district and village. Vishur MaloPurginskogo areas,
a rather low frequency combination PQQ (<0,70), indicating that
the
importation of bees southern subspecies (Table. 1).
Unfortunately,
the analysis was carried out on a very limited number of samples. For
more objective data is planned to increase the sample size of the local
population, as well as expand the number of genetic markers. Of
greatest interest to us are the northern regions of Udmurtia, which are
more likely to preserve populations of A m.mellifera, thanks to the
hard natural selection in northern conditions. For example, to preserve
the unique population Ammellifcra in Krasnovishersk district of the
Perm region. |
024.
Ильясов Р.А.,
Поскряков А.В., Колбина Л.М., Николенко А.Г. Сохранение Apis
m.mellifera в Удмуртской республике. Материалы Российской региональной
научно-практической конференции "Экологические и биологические основы
разведения пчел и диких пчелиных как опылителей энтомофильных культур в
условиях северо-восточного региона Российской Федерации". Ижевск. 2007.
С 79-81.
Для
определения подвидовой принадлежности пчел был использован полиморфизм
межгенного локуса COi-COil митохондриальной ДНК (мтДНК), комбинация PQQ
которого характеризует происхождение пчел от А.т.mellifera по
материнской линии (Ильясов и др., 2006). Всего было проанализировано 69
семей пчел с 11 пасек 6 районов Удмуртии (рис. 1).
Результаты
показали, что на большинстве пасек преобладали семьи, имеющие
происхождение от A.m.mellifera. Частота комбинации PQQ была очень
высокой (>0,95) на некоторых пасеках Камбарского, Глазовского,
Можгинского, Завьяловского, а в Мало-Пургинском районе частота
комбинации PQQ оказалась довольно низкой (<0,70). На пасеках с.
Шаркан Шарканского района, с. Постол Завьяловского района и д. Вишур
Мало-Пургинского районов наблюдалась довольно низкая частота комбинации
PQQ (<0,70), что свидетельствует о завозе пчел южных подвидов
(табл.
1).
К
сожалению, анализ проводился на очень ограниченном количестве образцов.
Для получения более объективных данных планируется увеличить объем
выборки из локальных популяций, а также расширить число генетических
маркеров. Наибольший интерес для нас представляют северные районы
Удмуртии, Пермского края, где имеются большие шансы на сохранение
популяций A.m.mellifera, благодаря более жесткому естественному отбору
в северных условиях. Так, например, сохранилась уникальная популяция
А.т.mellifera в Красновишерском районе Пермского края.
To
determine the subspecies of bees was used intergenic polymorphism loci
COi-COil mitochondrial DNA (mtDNA), which is characterized by a
combination of PQQ origin of bees from A.t.mellifera maternal (Ilyasov
et al., 2006). There were analyzed 69 bee colonies from 11 apiaries 6
Udmurtia regions (Fig. 1).
The
results showed that in most apiaries dominated family, originating from
Ammellifera. Frequency combination PQQ was very high (> 0.95) in
some apiaries Kambarka, Glazov, Mozhginsky, Zavyalovsky and in the area
of Little Purginskom frequency combinations PQQ was quite low
(<0.70). On apiaries with. Sharkan Sharkansky district with.
Postol
Zavyalovsky district and village. Vishur Little Purginskogo areas, a
rather low frequency combination PQQ (<0,70), indicating that
the
importation of bees southern subspecies (Table. 1).
Unfortunately,
the analysis was carried out on a very limited number of samples. For
more objective data is planned to increase the sample size of the local
population, as well as expand the number of genetic markers. Of
greatest interest to us are the northern regions of Udmurtia, Perm
region, where there are great chances of keeping populations
Ammellifera, thanks to the hard natural selection in northern
conditions. For example, to preserve the unique population
A.t.mellifera in Krasnovishersk district of the Perm region. |
023.
Ильясов Р.А.,
Поскряков А.В., Колбина Л.М., Николенко А.Г. Сохранение Apis mellifera
mellifera L. в Удмуртской республике. Пчеловодство. 2007. № 6. С. 13-14.
Сохранение
Apis mellifera mellifera L. в Удмуртской республике (Saving Apis
mellifera mellifera L. in the Udmurt Republic. Russian journal of
beekeeping) Результаты показали, что на большинстве пасек преобладают
семьи, происходящие от A. m. mellifera. Частота комбинации PQQ была
очень высокой (>0,95) в некоторых хозяйствах Камбарского,
Глазовского, Можгинского, Завьяловского районов. На пасеках
Малопургинского района частота комбинации PQQ оказалась довольно низкой
(<0,70). Такой же показатель был получен на пасеках с. Шаркан
Шарканского района, с. Постол Завьяловского района и д. Вишур
Малопургинского районов, что свидетельствует о завозе пчел южных
подвидов (табл.). К сожалению, анализ проводили на крайне ограниченном
числе образцов. Для получения более объективных данных планируется
увеличить объем выборки в локальных популяциях, а также расширить число
генетических маркеров для анализа генома в целом. Наибольший интерес
для нас представляют северные районы Удмуртии, где благодаря жесткому
естественному отбору (как, например, уникальная популяция A. m.
mellifera в Красновишерском районе Пермского края) велика вероятность
сохранения популяций A. m. mellifera. The results showed that most
apiaries dominated family, originating from A. m. mellifera. Frequency
combination PQQ was very high (> 0.95) in the number of farms
Kambarka, Glazov, Mozhginskosecond, Zavyalovsky areas. Apiaries Mat
lopurginskogo district frequency combination PQQ was quite low
(<0.70). such the same figure was derived from apiaries p.
Sharkan
Sharkansky District, p. Postol Zavyalovsky district and village. Vishur
Malopurginskogo areas, indicating that the importation bees southern
subspecies (Table.). Unfortunately, the analysis was performed at an
extremely a limited number of samples. for more objective data is
planned increase the sample size in the local populations, as well as
expand the number of Genetic markers for genome analysis in general. Of
greatest interest to us represent the northern regions of Udmurtia,
where, thanks to the hard natural selection (such as a unique
population of A. m. mellifera in Krasnovishersky District Perm Krai)
likely conservation of populations A. m. mellifera. Publication Name:
Ilyasov R.A., Poskryakov A.V. Kolbina L.M., Nikolenko A.G. Saving Apis
mellifera mellifera L. in the Udmurt Republic. Russian journal of
beekeeping. 2007. V. 6. P. 13-14. |
022.
Ilyasov R.A.,
Poskryakov A.V., Nikolenko A.G. Sequencing analysis of bees from Urals.
Materials of International conference "XLIV naukowa konferencja
pszczelarska". Pulawy. 2007. P. 29.
Classification
of a honey bees (Apis mellifera L.) has been based on morphometrical
methods before beginning of use of molecular methods in bees studying.
Modern systematics and phylogenetics often use molecular methods. In
particular, the methods based on polymorphism of DNA are applied to a
honey bee. Initial researches based on a restriction analysis (RFLP) of
mitochondrial DNA (mtDNA) (Smith, 1991), sequencing analysis of mtDNA
(Cornuet et al., 1991; Garnery et.al., 1992), analysis of polymorphism
of microsatellite loci (Estoup et al., 1995; Viard et al., 1998) have
shown existence only three evolutionary branches - A, M and C.
Following researches based on sequencing analysis of 2 subunit of gene
NADH- dehydrogenase (ND2) mtDNA (Arias and Sheppard, 1996), based on
RFLP analysis intergenic site between 1 and 2 subunit of genes
cytochrome-c-oxidase (COI-COII) of mtDNA by endonuclease DraI (Franck
et al., 2000; Palmer et al., 2000), based on analysis of microsatellite
loci polymorphisms (Franck et al., 2000) have shown existence fourth
evolutionary branch O. Further P.Franck et al. (2001) by DraI
endonuclease perform RFLP analysis of the intergenic locus COI-COII
mtDNA, has shown existence of five evolutionary branches A, M, C, O, Y.
In
recent time all subspecies and population of A.m.mellifera of an
evolutionary branch M are subject to intensive hybridization. Analysis
of frequencies of combination PQQ of intergenic locus COI-COII mtDNA in
populations of bees in Urals (Middle and Southern Urals) has been shown
existence of four reserves of subspecies A.m.mellifera (Ilyasov et al.,
2005).
Analysis
of nucleotide sequences of a fragment of gene ND2 with average size 688
b.p. in 12 samples of four populations has shown transitions in
positions 536, 621, 861, 1015, 1047 between sequences of gene ND2 of
the analysed samples. Transition Т>C in position 536 in samples
DQ181614 and DQ181618 lead to replacement aminoacid isoleucine Ile by
threonine Thr. Transversion was not revealed. Numbering of sequences is
concerning sequence full mtDNA of A.m.ligustica from GenBank
NCBI (NC
001566).
Analysed
sequences of gene ND2 of bees from Ural population were deposited to
GenBank (http://www.ncbi.nlm.nih.gov) at numbers DQ181611-DQ181622.
Sequence comparison of gene ND2 of the Urals bee samples with bees from
European populations A.m.mellifera (AY114495, U35758, U35759, U35760)
has shown their big similarity that shows their unity of an origin and
genetic relationship.
Thus,
part of unique European population A.m.mellifera which is subdivided
into four subpopulations described by significant similarity with
European populations of A.m.mellifera was still kept in Urals. For
successful preservation gene pool of A.m.mellifera and restoration of
its initial area in Urals is necessary more detailed research of bees
of this region. |
021.
Ильясов
Р.А., Поскряков А.В., Николенко А.Г. Секвенционный анализ Apis
mellifera mellifera L. на Урале. Материалы XIII съезда Русского
энтомологического общества "Проблемы и перспективы общей энтомологии".
Краснодар. 2007. С. 136-137.
SEQUENCING ANALYSIS OF APIS
MELLIFERA MELLIFERA L. IN URALS
R.A.Ilyasov, A.V.Poskryakov, A.G.Nikolenko
Внутривидовая
систематика медоносной пчелы (Apis mellifera L.) до 60-х годов 20 века,
то есть до начала использования молекулярных методов в изучении пчел,
была основана на морфометрических методах. Современная систематика и
филогенетика все чаще использует молекулярные методы, в частности, для
медоносной пчелы применяются методы, основанные на ДНК-полиморфизме.
Первоначальные исследования на основе рестрикционного анализа (RFLP)
митохондриальной ДНК (мтДНК) (Smith, 1991), секвенционного анализа
мтДНК (Cornuet et al., 1991; Garnery et.al., 1992), анализа
полиморфизма микросателлитных локусов (Estoup et al., 1995; Viard et
al., 1998) показали существование только трех эволюционных ветвей - А,
М и С. Последующие исследования основанные на секвенционном анализе
гена 2 субъединицы NADH-дегидрогеназы (ND2) мтДНК (Arias and Sheppard,
1996), RFLP анализе межгенного участка между генами 1 и 2 субъединицы
цитохром оксидазы (COI-COII) мтДНК (Franck et al., 2000; Palmer et al.,
2000) с использованием эндонуклеазы DraI, анализе полиморфизма
микросателлитных локусов (Franck et al., 2000) показали существование
также четвертой эволюционной ветви О. В дальнейшем P.Franck et al.
(2001) на основе RFLP анализа межгенного участка COI-COII мтДНК с
использованием рестриктазы DraI, показал существование пяти
эволюционных ветвей А, М, С, О, Y.
На текущий момент подвиды
подвержены интенсивной гибридизации, чего не избежали и локальные
популяции A.m.mellifera эволюционной ветви М. На основе анализа частот
комбинации PQQ межгенного локуса COI-COII мтДНК в популяциях пчел на
Урале (Средний и Южный Урал) нами все же было показано существование
четырех резерватов подвида A.m.mellifera (Ильясов с соавт., 2005).
Анализ
нуклеотидной последовательности фрагмента гена ND2 со средней
протяженностью 688 п.н. в 12 образцах четырех выделенных нами популяций
показал, что между нуклеотидными последовательностями гена ND2
проанализированных образцов наблюдались транзиции в положениях 536,
621, 861, 1015, 1047, где транзиция Т>С в положении 536 в
образцах
DQ181614 и DQ181618 приводила к аминокислотной замене изолейцина Ile на
треонин Thr. Трансверсий не было обнаружено. Нумерация нуклеотидной
последовательности ведется относительно последовательности полной
митохондриальной ДНК A.m.ligustica из генбанка NCBI (NC 001566).
Проанализированные
нуклеотидные последовательности гена ND2 пчел уральской популяции были
депонированны в генбанк (http://www.ncbi.nlm.nih.gov) под номерами
DQ181611-DQ181622. Сравнение нуклеотидной последовательности гена ND2
уральских образцов с аналогичными последовательностями образцов
A.m.mellifera европейских популяций (AY114495, U35758, U35759, U35760)
показало их большое сходство, что показывает их единство происхождения
и генетическое родство.
Таким образом, на Урале еще сохранилась
часть уникальной европейской популяции A.m.mellifera, характеризующаяся
значительным сходством по материнской линии мтДНК с европейскими
популяциями A.m.mellifera. Для успешного сохранения генофонда
A.m.mellifera и восстановления его первоначального ареала на Урале
необходимо более детальное исследование пчел данного региона и
определение границ распространения.
Intraspecific taxonomy of the
honey bee (Apis mellifera L.) to the 60s of the 20th century, that is,
before the start of the use of molecular methods in the study of bees,
was based on morphometric techniques. Modern taxonomy and phylogenetics
are increasingly using molecular methods, in particular, for the
honeybee used methods based on DNA polymorphism. Initial studies on the
basis of restriction enzyme analysis (RFLP) of the mitochondrial DNA
(mtDNA) (Smith, 1991), analysis of mtDNA sekventsionnogo (Cornuet et
al., 1991; Garnery et.al., 1992), microsatellite polymorphism loci
(Estoup et al., 1995; Viard et al., 1998) revealed the existence of
only three branches of evolution - A, M and C. Subsequent studies based
on the analysis of gene sekventsionnom 2 subunit of NADH-dehydrogenase
(ND2) mtDNA (Arias and Sheppard, 1996), RFLP analysis of the intergenic
region between 1 and 2 genes, cytochrome oxidase subunit (COI-COII)
mtDNA (Franck et al., 2000; Palmer et al., 2000) using endonuclease
DraI, polymorphism analysis of microsatellite loci (Franck et al.,
2000) showed the existence of the Fourth evolutionary branch O. Later
P.Franck et al. (2001) based on RFLP analysis of the intergenic region
of mtDNA COI-COII using the restriction enzyme DraI, revealed the
existence of five evolutionary branches A, M, C, O, Y.
To date, the
subspecies susceptible to intense hybridization, which did not escape
the local population and evolutionary branch Ammellifera M. The
analysis of combination frequencies PQQ intergenic locus COI-COII mtDNA
in populations of bees in the Urals (Middle and South Ural), we still
have shown the existence of four Reserves subspecies Ammellifera
(Ilyasov et al., 2005).
Nucleotide sequence analysis of the gene
fragment ND2 having an average length of 688 bp 12 samples of four
populations isolated by us has shown that between the nucleotide
sequences of the gene analyzed samples ND2 observed transitions at
positions 536, 621, 861, 1015, 1047, where the transitions T> C
at
position 536 in samples DQ181614 and DQ181618 resulted in an amino acid
substitution of isoleucine Ile threonine Thr. Transversions were
detected. Numbering is carried out with respect to the nucleotide
sequence of the complete mitochondrial DNA sequence from genebank
Amligustica NCBI (NC 001566).
Analyzed the nucleotide sequence of
the gene ND2 bees Ural population was deposited into the genebank
(http://www.ncbi.nlm.nih.gov) under the numbers DQ181611-DQ181622.
Comparison of the nucleotide sequence of the gene ND2 Ural models with
similar sequences of samples Ammellifera European populations
(AY114495, U35758, U35759, U35760) showed their great similarity that
reveals their common origin and genetic relationship.
Thus, in the
Urals, it has preserved a unique part of the European population
Ammellifera, characterized by considerable similarity maternal mtDNA
European populations Ammellifera. In order to successfully preserve the
gene pool Ammellifera and restore its original habitat in the Urals
need for more detailed study of the bees in the region and the
definition of the boundaries of distribution. |
020.
Ilyasov
R.A., Poskryakov A.V., Komissar A.D., Nikolenko A.G. Phylogenetic
Analisys Of Ukrainnian Bees. Materials of III International young
scientists conference Biodiversity "Ecology. Adaptation. Evolution".
Odessa. 2007. P. 117.
Some
hypotheses about an origin of the Ukrainian bees are known. The first
approves, that they occur from Apis mellifera mellifera L. (Taranov,
1987), the second - from Apis mellifera сarnica Pollmann, 1879 (Gubin,
1977), the third - from hybridization of subspecies A.m.mellifera and
Apis mellifera carpatica Foti et al., 1965 (Bilash, Krivtsov, 1991).
F.Ruttner (1988) by morphometrical researches attributed the Ukrainian
bees to Apis mellifera macedonica Ruttner, 1987, but did not include
them in a map of distribution of A.m.macedonica, because he had not
enough of samples. For define valid taxonomy position of the Ukrainian
bees it is necessary to carry out phylogenetics researches by
sequencing analysis.
In this work we
has been
determined nucleotide sequence of a fragment of gene ND2 of
mitochondrial DNA (mtDNA) three samples of bees from Ukraine
(A.D.Komissar's apiary near Kiev), three samples of bees from Russia
(Republic Bashkortostan, Burzjansky region) from apiaries the
Kapova-cave, the Koran-Elga, and from hollow tree nesting bees from
national park "Shulgan-Tash". Analysed sequences of these bee samples
have been deposit to GenBank (DQ181611-DQ181623, DQ361088-DQ361090). By
comparison and calculation of average genetic distances between samples
shown the close genetic relationship of bees from Ukraine from
A.D.Komissar's apiary and bees of A.m.macedonica from Greece. Bees of
subspecies A.m.mellifera from Russia, Apis mellifera ligustica Spinola,
1806 from Italy, A.m.carnica from Austria and Germany had mostly
genetically distant from the Ukrainian bees.
Thus, sequencing
analysis of a fragment of gene ND2 of mtDNA shown the Ukrainian bees
has been attributed to subspecies A.m.macedonica. For the greater
objectivity data we planned to expand number of bee samples.
До сих пор точно
не
известно о происхождении пчел Украины и их подвидовой принадлежности.
Современная таксономия их относит к подвиду Apis mellifera sossimai
Engel, 1999. Однако секвенционный анализ фрагмента гена ND2 мтДНК
показал, что украинские пчелы могут относятся к подвиду A.m.macedonica.
|
019.
Ильясов Р.А.,
Поскряков А.В., Николенко А.Г. Митохондриальная ДНК в эволюционных
исследованиях пчел. Материалы школы-семинара молодых ученых Уфимского
научного центра РАН и Волго-Уральского региона по физико-химической
биологии и биотехнологии "Биомика – наука XXI века". Уфа.
2007. С.
52-54.
Apis
mellifera имеет необычайно огромный естественный ареал распространения,
который простирается от юга Скандинавского полуострова на севере до
мыса Доброй Надежды на юге; от Дакара на западе до Алтая, Маскада и
западных границ Китая на востоке [9]. Ранее с использованием
мультивариантного анализа морфометрических признаков было определено
существование 25 подвидов пчел [8].
В нашей работе
были
использованы пчелы подвида A.m.mellifera из бурзянской и татышлинской
популяций республики Башкортостан (DQ181611-DQ181622) и вишерской и
южно-прикамской популяций Пермского края (DQ361088-DQ361090), которые
были ранее выделены нами на основе изучения полиморфизма межгенного
локуса COI-COII мтДНК [1]. Также были использованы пчелы из украинской
популяции с пасеки под Киевом, любезно предоставленные А.Д.Комиссаром.
Для проведения секвенционного анализа было взято по три образца из
описанных выше популяций. Для сравнения были использованы нуклеотидные
последовательности фрагмента гена ND2 мтДНК других подвидов
A.mellifera. Для укоренения филогенетического построения были
использованы последовательности пчел другого вида - Apis cerana и
другого рода - Mellipona bicolor.
На основе
сравнения
нуклеотидных последовательностей была построена дендрограмма с
использованием программы MEGA 3.1 и метода кластеризации ближайшего
соседа и медианная сеть [4] с использованием программы NETWORK. В
качестве референсной была использована нуклеотидная последовательность
фрагмента ND2 мтДНК подвида A.m.anatoliaca.
На дендрограмме и
медианной сети наблюдалось разделение на четыре группы, названные
эволюционными ветвями А, О, М и С. Эволюционная ветвь А объединила
большинство представителей африканских подвидов пчел. Она
подразделялась на две группы, одна из которых объединила большинство
африканских подвидов пчел к югу от Сахары и африканизированных пчел из
Бразилии. Другая группа объединила северо-африканские, а также
несколько сридеземноморских подвидов, что можно объяснить гибридизацией
пчел Сицилии. Кроме того, в этой эволюционной ветви выделяется еще одна
небольшая группа африканских пчел, объединяющая представителей подвидов
из Кении и Сенегала.
Эволюционная
ветвь О
объединила представителей подвидов A.m.meda и A.m.syriaca из Сирии и
A.m.lamarckii из Египта. Ранее [2, 6] подвид A.m.lamarckii также был
отнесен к эволюционной ветви О, тогда как другие [7] относили его к
эволюционной ветви А.
Эволюционная
ветвь М
состояла в основном из представителей A.m.mellifera уральских и
европейских популяций из Швейцарии, Франции, Испании и Норвегии. Однако
в эту группу также вошли по два представителя подвидов A.m.sicula с
Сицилии и A.m.ligustica из Италии, что может быть объяснено их
гибридизацией с A.m.mellifera.
Эволюционная
ветвь С
представлена наиболее многочисленно по числу подвидов и объединяла
подвиды пчел Средиземноморья, Ближнего Востока и Кавказа. Здесь
наиболее выделялась огромная центральная группа, которая является
точкой экспансии подвидов.
Использование в
сравнении последовательностей фрагмента гена ND2 мтДНК пчел из рода
Mellipona, который очень рано дивергировал от предков рода Apis,
позволило заключить, что пчелы видов Apis mellifera и Apis cerana
являются по отношению сестринскими видами.
Путем сравнения
нуклеотидных последовательностей фрагмента гена ND2 мтДНК всех образцов
пчел с использованием программы DNASTAR были рассчитаны проценты
различий между Mellipona bicolor и каждым из видов рода Apis
–
A.mellifera и A.cerana, которые были равны 22,18% и 23,02%,
соответственно. Между A.mellifera и A.cerana процент различий был равен
15,54%. Для Drosophila было показано [5], что различия нуклеотидной
последовательности мтДНК в 2% соответствует времени дивергенции в 1
миллион лет, что было использовано в некоторых работах применительно ко
времени дивергенции пчел [2, 3]. Учитывая данную скорость дивергенции
мы рассчитали время дивергенции, которое между Mellipona bicolor и
A.mellifera равно 11,09 млн. лет, между Mellipona bicolor и A.cerana
равно 11,5 млн.лет, а между A.mellifera и A.cerana равна 7,77 млн. лет.
Виды A.mellifera и A.cerana дивергировали от Mellipona bicolor в
среднем 11,3 млн. лет назад. Виды A.mellifera и A.cerana, возможно,
дивергировали от общего предка в среднем 3,89 млн. лет назад, где
A.cerana на 0,42 млн. лет раньше отделилась от общего предка,
следовательно A.mellifera имеет возраст 3,47 млн. лет, а A.cerana
– 4,31 млн. лет.
Мы показали
высокую
степень генетического родства уральских и западноевропейских популяций
A.m.mellifera - единственных представителей эволюционной ветви М.
Apis mellifera
has an
unusually huge natural area of distribution that extends from the
south of Scandinavia in the north to the Cape of Good Hope in the
south; Dakar on the west to the Altai Maskada and western borders of
China to the east. [9] Previously, using multivariate analysis of
morphometric characters was determined the existence of 25 subtypes of
bees. [8]
In our work we
used bee
subspecies of Ammellifera Burzyan tatyshlinskoy populations and the
Republic of Bashkortostan (DQ181611-DQ181622) and Visherskaya Kama
region and southern populations of the Perm Territory
(DQ361088-DQ361090), which were previously allocated on the basis of
our study of polymorphism of the intergenic locus COI-COII mtDNA [1].
Bees were also used from the Ukrainian population from the apiary near
Kiev, courtesy A.D.Komissarom. To perform the analysis were taken
sekventsionnogo three specimens of the above described populations. For
comparison, we used the nucleotide sequences of mtDNA gene fragment ND2
other subspecies A.mellifera. For rooting phylogenetic sequence were
used another type of bee - Apis cerana another kind - Mellipona bicolor.
Based on a
comparison of
the nucleotide sequences of the dendrogram was constructed using MEGA
3.1 program and the nearest neighbor clustering method and median net
[4] using the program NETWORK. As reference was used nucleotide
sequence fragment ND2 mtDNA subspecies Amanatoliaca.
In the dendrogram
and
media networks division was observed in four groups, called
evolutionary branch A, O, M and S. evolutionary branch A united the
majority of the African subspecies of bees. It is divided into two
groups, one of which joined the majority of the African subspecies of
bees in sub-Saharan and Africanized bees in Brazil. Another group has
united North African, as well as several sridezemnomorskih subspecies,
which can be explained by hybridization bees Sicily. In addition, in
this evolutionary branch stands another small group of African bees,
uniting representatives of subspecies from Kenya and Senegal.
On the
evolutionary
branch brought together representatives of subspecies and Ammeda
Amsyriaca Amlamarckii from Syria and Egypt. Earlier [2, 6] Amlamarckii
subspecies has also been attributed to the evolutionary branch about,
while others [7] attributed it to the evolutionary branch A.
The evolutionary
branch
of M consisted mainly of representatives Ammellifera Ural and European
populations from Switzerland, France, Spain and Norway. However, this
group also includes two representatives from the subspecies Amsicula
Amligustica Sicily and in Italy that can be explained by their
hybridization to Ammellifera.
With evolutionary
branch
is represented by the most plentiful in the number of sub-species and
sub-species of bees unite the Mediterranean, the Middle East and the
Caucasus. Here, the most by huge central group, which is the point of
expansion subspecies.
Using the
comparison of
sequences of mtDNA gene fragment ND2 bees of the genus Mellipona, which
is very early ancestors diverged from the genus Apis, allowed to
conclude that the bee species Apis mellifera and Apis cerana are
against sister species.
By comparing the
nucleotide sequences of mtDNA gene fragment ND2 all samples bees using
DNASTAR software percentages were calculated differences between
Mellipona bicolor and each of the species of the genus Apis -
A.mellifera and A.cerana, which were equal to 22.18% and 23.02%,
respectively. Between A.mellifera and A.cerana percentage difference
was equal to 15.54%. For Drosophila showed [5] that the differences in
the nucleotide sequence obtained corresponds to 2% divergence time of 1
million years, were used in some work in relation to the time of the
divergence of bees [2, 3]. Given this divergence, we calculated the
rate of divergence time, which is between Mellipona bicolor and
A.mellifera still 11,090,000. Years between Mellipona bicolor and
A.cerana equal to 11.5 million years, and between A.mellifera and is
A.cerana 7770000. years. Forms and A.mellifera A.cerana diverged from
Mellipona bicolor average 11.3 mln. Years ago. Forms and A.mellifera
A.cerana, may have diverged from a common ancestor by an average 3.89
million. Years ago where A.cerana to 0.42 million. Years earlier
separated from a common ancestor, so A.mellifera is age 3, 47 mln.
years and A.cerana - 4,31 Mill. years.
We have shown a
high
degree of genetic relatedness of the Ural and Western European
populations Ammellifera - the only representatives of the lineage
M. |
018.
Ильясов Р.А.,
ПетуховА.В., ПоскряковА.В., НиколенкоА.Г. Локальные популяции Apis
mellifera mellifera L. на Урале. Генетика. 2007. №43 (6). С. 855-858.
Локальные
популяции Apis mellifera mellifera L. на Урале (Local populations of
Apis mellifera mellifera L. in the Urals) Межгенный регион COI-COII
митохондриальной ДНК (мтДНК) медоносной пчелы был использован для
получения сведений о сохранившихся локальных популяциях Apis mellifera
mellifera L. на территории Среднего и Южного Урала. В результате
анализа пчелиных семей этого региона были обнаружены пасеки с большой
долей встречаемости семей, имеющих происхождение от А. т. mellifera по
материнской линии. Результаты этой работы подтверждают предположения о
сохранении резерватов А. т. mellifera на Урале и одновременно являются
начальным этапом работ по сохранению генофонда этого ценного для всей
России подвида пчелы. Intergenic region COI-COII mitochondrial DNA
(mtDNA) of the honey bee has been used for information about the safety
of local populations Apis mellifera mellifera L. on territory of
Central and Southern Urals. An analysis of bee colonies in the region
were found apiary with a high degree of occurrence of families with
origins from A. m. mellifera through the maternal line. The results of
this study confirm the assumption of maintaining Reserves A. m.
mellifera in the Urals and at the same time are the initial stage of
work on this valuable gene pool for the entire Russian bee subspecies.
Publication Name: Ilyasov R.A., Petukhov A.V., Poskryakov A.V.
Nikolenko A.G. Local populations of Apis mellifera mellifera L. in the
Urals. Russian Journal of Genetics. 2007. V.43 (6), P.
855-858. |
017.
Ильясов Р.А.,
Поскряков А.В., Николенко А.Г. Локальные популяции медоносной пчелы
подвида Apis mellifera mellifera L. на Урале. Материалы международной
конференции "Досягнення i проблеми генетики, селкциii та
бiотехнологii". Киев. 2007. Т. 1. С. 231-235.
Нами
было показано существование четырёх сохранившихся локальных популяций
Apis mellifera mellifera L. на Урале: вишерской, южно-при- камской,
татышлинской и бурзянской. Исследование полиморфизма отдельных локусов
ядерной и митохондриальной ДНК выявило тесное генетическое родство,
инбридинг и дефицит гетерозигот в уральских популяциях A.m.mellifera.
Филогенетический анализ по локусу мтДНК показал генетическое родство
уральских и западноевропейских популяций A.m.mellifera. Возможно, что
подвид A.m.mellifera является единственным представителем внутривидовой
эволюционной ветви М, а предковой формой подвидов Apis mellifera L.
могут быть пчелы эволюционной ветви С.
We have shown the
existence of the four remaining local populations of Apis mellifera
mellifera L. in the Urals: Vishera, South Examples Kamsky tatyshlinskoy
and Burzyan. A study of polymorphism loci separate nuclear and
mitochondrial DNA revealed a close genetic relationship, inbreeding and
a lack of heterozygotes in the Ural population Ammellifera.
Phylogenetic analysis of mtDNA locus showed the genetic relationship of
the Urals and Western European populations Ammellifera. Perhaps
Ammellifera subspecies is the only representative of intraspecific
evolutionary branches of M and the ancestral form of the subspecies
Apis mellifera L. bees may be evolutionary branch C. |
016.
lyasov R.A.,
Petukhov A.V., Poskryakov A.V., Nikolenko A.G. Local honeybee (Apis
mellifera mellifera L.) populations in the Urals. Russian Journal of
Genetics. 2007. V. 43. No. 6. P. 709-711.
Local
honeybee (Apis mellifera mellifera L.) populations in the Urals The
COI-COII intergenic region of mitochondrial DNA (mtDNA) was studied in
local honeybee ( Apis mellifera mellifera ) L. populations from the
Middle and Southern Urals. Analysis of bee colonies in these regions
revealed apiaries enriched in families descending from A. m. mellifera
in the maternal lineage. These results confirm the suggestion of
preservation of A. m. mellifera refuges in the Urals and provide
grounds for work on the preservation of the gene pool of this bee
variety, valuable for all Russia. Publication Name: Ilyasov R.A.,
Petukhov A.V., Poskryakov A.V., Nikolenko A.G. Local honeybee (Apis
mellifera mellifera L.) populations in the Urals. Russian Journal of
Genetics. 2007. V. 43 (6). P. 709-711. |
015.
Колбина
Л.М., Непейвода С.Н., Ильясов Р.А., Поскряков А.В., Николенко А.Г.
Использование морфологических и молекулярно-генетических методов для
исследования Apis mellifera. Аграрная наука Евро-Северо-Востока. № 10.
С. 57-58. 2007.
Для
определения породной принадлежности пчел с помощью
молекулярногенетических нами был использован полиморфизм межгенного
локуса COI-COH митохондриальной ДНК (мтДНК), комбинация PQQ которого
характеризует происхождение пчел от A.m.mellifera по материнской линии.
Из морфологических методов в наибольшем объеме использовались
морфометрические признаки (длина хоботка, кубитальный' и тарзальный
индексы, ширина третьего тергита, дис- коидальное смещение). Всего было
проанализировано 63 семьи пчел с 11 пасек из 6 районов республики.
Результаты
молекулярно-генетических исследований показали, что на большинстве
пасек преобладали семьи, имеющие происхождение от A.m. mellifera.
Частота комбинации PQQ была высокой (>0,95) на некоторых пасеках
Можгинского и Завьяловского районов, а в большинстве других районов
наблюдалась довольно низкая частота комбинации PQQ (<0,70), что
свидетельствует о завозе пчел южных подвидов (табл. 1). Изучение
морфометрических признаков в целом показало большую гибридизацию и
изменчивость пчелиных семей. Преобладающее количество среднерусских
пчел наблюдалось в Можгинском районе, в остальных процент семей
среднерусской породы крайне низок.
Результаты
молекулярно-генетического и морфологического методов более чем на 66%
совпали в Можгин- ском районе, а в Шарканском оказались диаметрально
противоположны. Это по- зволяет с уверенностью судить только об одной
выявленной популяции среднерусской породы пчел в Можгинском районе, во
всех остальных пчелы сильно гибридизированны южными породами
Проведенные исследования показали также, что ни один из использованных
методов не стоит абсолютизировать. Поскольку аборигенными пчелами для
всего Поволжья, в том числе и Удмуртской Республики, были среднерусские
пчелы, то есть пчелы Apis mellifera melli- fera L, а завезенные семьи
южных пород составляли небольшой процент от общего количества
разводимых пчел, это привело к тому, что большая часть гибридизации
местных пчел произошла по мужской линии, которую использованная
молекулярно-генетическая методика, к сожалению, учесть не может. С
другой стороны, большая вариабельность морфологических признаков,
появившаяся в результате гибридизации привела к тому, что часть
помесных пчел может по экстерьеру соответствовать среднерусской породе,
таковой, по сути, не являясь. Поэтому достоверные результаты могут быть
получены только при использовании как морфологических, так и
молекулярногенетических методов исследования.
To determine the
breed
of bees using molekulyarnogeneticheskih we used polymorphism of the
intergenic locus COI-COH mitochondrial DNA (mtDNA), which is
characterized by a combination of PQQ origin of bees from Ammellifera
maternal. From morphological methods were used in the greatest amount
of morphometric features (proboscis, cubital 'and tarsal index, the
width of the third tergite disk koidalnoe offset). There were analyzed
63 bee colonies from 11 apiaries of 6 regions of the republic.
The results of
the
molecular genetic studies have shown that in most apiaries dominated
family, originating from the Am mellifera. Frequency combination PQQ
was high (> 0.95) in some apiaries Mozhginsky and Zavyalovsky
areas,
and in most other areas, there is quite a low frequency combination PQQ
(<0,70), indicating that the importation of bees southern
subspecies
(Table. 1). The study of morphometric characters in general showed
great variability, hybridization and bee colonies. The vast number of
Central Russian bees was observed in Mozhginsky area, the percentage of
families in the rest of Central Russian breed is extremely low.
The results of
molecular
genetic and morphological methods for more than 66% in matched Mozhgin-
Raion, and Sharkan appeared diametrically opposed. This makes it
possible to judge with certainty only one of the identified populations
of Central Russian breed of bees in Mozhginsky area in all other bee
species strongly hybridized Southern Studies also showed that none of
the methods used is not absolute. Since the native bees for the whole
Volga region, including the Republic of Udmurtia were Central Russian
bees, ie bee Apis mellifera melli- fera L, a southern family imported
breeds were a small percentage of the total farmed bees, this has led
to the fact that most of the hybridization of native bees occurred in
the male line, which used molecular genetic techniques, unfortunately,
can not be taken into account. On the other hand, a large variability
of morphological characters that appeared as a result of hybridization
has led to the fact that part of the hybrid bees can match the exterior
of the Central Russian breed, per se, in fact, not being. Therefore,
accurate results can be obtained only when using both morphological and
molekulyarnogeneticheskih methods. |
014.
Ильясов Р.А.,
Поскряков А.В., Николенко А.Г. Эволюция медоносной пчелы Apis mellifera
L. Материалы международной конференции "Current Evolutionary Thinking
in Biology, Medicine and Sociology". Новосибирск. 2007. С. 55-56.
Apis
mellifera
имеет необычайно огромный естественный ареал распространения, который
простирается от юга Скандинавского полуострова на севере до мыса Доброй
Надежды на юге; от Дакара на западе до Алтая, Маскада и западных границ
Китая на востоке (Ruttner et al., 1978; Sheppard, Meixner, 2003). Ранее
с использованием мультивариантного анализа морфометрических признаков
было определено существование 25 подвидов пчел (Ruttner, 1992).
Современная номенклатура, основанная на молекулярных данных,
подтверждает предыдущие результаты, но с некоторой поправкой на состав
подвидов.
Как выяснилось,
для
получения окончательной филогенетической структуры и определения
структуры эволюционной ветви М, в частности статуса подвида
A.m.mellifera, недоставало нескольких образцов из уже ранее известных
чистых линий на Урале. Поэтому для филогенетического анализа были
использованы пчелы подвида A.m.mellifera из бурзянской и татышлинской
популяций республики Башкортостан (DQ181611-DQ181622) и вишерской и
южно-прикамской популяций Пермского края (DQ361088-DQ361090), которые
были ранее выделены нами на основе изучения полиморфизма межгенного
локуса COI-COII мтДНК (Ильясов с соавт., 2006). Также были использованы
пчелы из украинской популяции с пасеки под Киевом, любезно
предоставленные А.Д.Комиссаром. Для сравнения были использованы
нуклеотидные последовательности фрагмента гена ND2 мтДНК других
подвидов A.mellifera. Для укоренения филогенетическго построения были
использованы последовательности пчел другого вида - Apis cerana и
другого рода - Mellipona bicolor.
На основе
сравнения
нуклеотидных последовательностей была построена дендрограмма с
использованием программы MEGA 3.1 и метода кластеризации ближайшего
соседа и медианная сеть (Bandelt, Dress, 1992; Makarenkov, Legendre,
2004) с использованием программы NETWORK. В качестве референсной была
использована нуклеотидная последовательность фрагмента ND2 мтДНК
подвида A.m.anatoliaca. На дендрограмме и медианной сети наблюдалось
разделение на четыре группы, названные эволюционными ветвями А, О, М и
С.
Эволюционная
ветвь А
объединила в основном представителей африканских подвидов пчел. Она
подразделялась на две группы, одна из которых объединила большинство
африканских подвидов пчел к югу от Сахары и африканизированных пчел из
Бразилии. Другая группа объединила северо-африканские, а также
несколько сридеземноморских подвидов, что можно объяснить гибридизацией
пчел Сицилии. Кроме того, в этой эволюционной ветви выделяется еще одна
небольшая группа африканских пчел, объединяющая представителей подвидов
из Кении и Сенегала.
Эволюционная
ветвь О
объединила представителей подвидов A.m.meda и A.m.syriaca из Сирии и
A.m.lamarckii из Египта. M.C.Arias, W.S.Sheppard (1996), P.Franck et
al. (2000) в своих работах также отнесли подвид A.m.lamarckii к
эволюционной ветви О, тогда как ранее F.Ruttner et al. (1988) относил к
эволюционной ветви А.
Эволюционная
ветвь М
состояла в основном из представителей A.m.mellifera уральских и
европейских популяций из Швейцарии, Франции, Испании и Норвегии. Однако
в эту группу также вошли по два представителя подвидов A.m.sicula с
Сицилии и A.m.ligustica из Италии, что может быть объяснено их
гибридизацией с A.m.mellifera. По нашим данным A.m.mellifera является
единственным представителем эволюционной ветви М..
Эволюционная
ветвь С
представлена наиболее многочисленно по числу подвидов и объединяла
подвиды пчел Средиземноморья, Ближнего Востока и Кавказа. Здесь
наиболее выделялась огромная центральная группа, которая, возможно,
является точкой экспансии подвидов.
Использование в
сравнении последовательностей фрагмента гена ND2 мтДНК пчел из рода
Mellipona, который очень рано дивергировал от предков рода Apis,
позволило заключить, что пчелы видов Apis mellifera и Apis cerana
являются по отношению сестринскими видами.
Путем сравнения
нуклеотидных последовательностей фрагмента гена ND2 мтДНК всех образцов
пчел с использованием программы DNASTAR были рассчитаны проценты
различий между Mellipona bicolor и каждым из видов рода Apis
–
A.mellifera и A.cerana, которые были равны 22,18% и 23,02%,
соответственно. Между A.mellifera и A.cerana процент различий был равен
15,54%. DeSalle et al. (1987) в своей работе показали для Drosophila,
что различия нуклеотидной последовательности мтДНК в 2% соответствует
времени дивергенции в 1 миллион лет, что было использовано
применительно ко времени дивергенции пчел M.C.Arias, W.S.Sheppard
(1996, 2005). Учитывая данную скорость дивергенции мы рассчитали время
дивергенции, которое между Mellipona bicolor и A.mellifera равно 11,09
млн. лет, между Mellipona bicolor и A.cerana равно 11,5 млн.лет, а
между A.mellifera и A.cerana равна 7,77 млн. лет. Виды A.mellifera и
A.cerana дивергировали от Mellipona bicolor в среднем 11,3 млн. лет
назад. Виды A.mellifera и A.cerana, возможно, дивергировали от общего
предка в среднем 3,89 млн. лет назад, где A.cerana на 0,42 млн. лет
раньше отделилась от общего предка, следовательно A.mellifera имеет
возраст 3,47 млн. лет, а A.cerana – 4,31 млн. лет.
Таким образом,
проведенные нами исследования показали высокую степень генетического
родства уральских и западноевропейских популяций A.m.mellifera -
единственных представителей эволюционной ветви М. Показано, что
предковой формой вида Apis mellifera L. могут являться пчелы
эволюционной ветви С. Результат анализа украинских пчел, подтвердил их
принадлежность к подвиду A.m.macedonica. Пчелы A.cerana и A.mellifera
по нашим данным являются сетринскими видами по отношению друг к другу.
Apis mellifera
has an
unusually huge natural area of distribution that extends from the
south of Scandinavia in the north to the Cape of Good Hope in the
south; Dakar on the west to the Altai Maskada and western borders of
China to the east (Ruttner et al., 1978; Sheppard, Meixner, 2003).
Previously, using a multivariate analysis of morphometric
characteristics it was determined the existence of 25 subspecies of
bees (Ruttner, 1992). The modern nomenclature, based on the molecular
data confirms the previous results, but with some amendments to the
composition of the subspecies.
As it turned out,
for
the final determination of the phylogenetic structure and evolutionary
branch structure of M, in particular the status of the subspecies
Ammellifera, missing several samples of previously known pure lines in
the Urals. Therefore, for the phylogenetic analysis were used bee
subspecies of Ammellifera Burzyan and tatyshlinskoy population of the
republic of Bashkortostan (DQ181611-DQ181622) and Vishera and southern
populations of Kama region of Perm Krai (DQ361088-DQ361090), which were
previously allocated on the basis of our study of polymorphism of the
intergenic locus COI- COII mtDNA (Ilyasov et al., 2006). Bees were also
used from the Ukrainian population from the apiary near Kiev, courtesy
A.D.Komissarom. For comparison, we used the nucleotide sequences of
mtDNA gene fragment ND2 other subspecies A.mellifera. For rooting
filogeneticheskgo were used for constructing the sequence of another
species of bees - Apis cerana another kind - Mellipona bicolor.
Based on a
comparison of
the nucleotide sequences was constructed dendrogram using the program
MEGA 3.1 and the nearest neighbor clustering method and Media Network
(Bandelt, Dress, 1992; Makarenkov, Legendre, 2004) using the program
NETWORK. As reference was used nucleotide sequence fragment ND2 mtDNA
subspecies Amanatoliaca. In the dendrogram and media networks division
was observed in four groups, called evolutionary branch A, O, M and S.
Evolutionary
branch A
united mainly of African subspecies of bees. It is divided into two
groups, one of which joined the majority of the African subspecies of
bees in sub-Saharan and Africanized bees in Brazil. Another group has
united North African, as well as several sridezemnomorskih subspecies,
which can be explained by hybridization bees Sicily. In addition, in
this evolutionary branch stands another small group of African bees,
uniting representatives of subspecies from Kenya and Senegal.
On the
evolutionary
branch brought together representatives of subspecies and Ammeda
Amsyriaca Amlamarckii from Syria and Egypt. M.C.Arias, W.S.Sheppard
(1996), P.Franck et al. (2000) in his work as a subspecies Amlamarckii
attributed to evolutionary branch O, whereas previously F.Ruttner et
al. (1988) refers to the evolutionary branch A.
The evolutionary
branch
of M consisted mainly of representatives Ammellifera Ural and European
populations from Switzerland, France, Spain and Norway. However, this
group also includes two representatives from the subspecies Amsicula
Amligustica Sicily and in Italy that can be explained by their
hybridization to Ammellifera. According to our data Ammellifera the
sole representative of the evolutionary branch of M ..
With evolutionary
branch
is represented by the most plentiful in the number of sub-species and
sub-species of bees unite the Mediterranean, the Middle East and the
Caucasus. Here, the most by huge central group, which may be the point
of expansion subspecies.
Using the
comparison of
sequences of mtDNA gene fragment ND2 bees of the genus Mellipona, which
is very early ancestors diverged from the genus Apis, allowed to
conclude that the bee species Apis mellifera and Apis cerana are
against sister species.
By comparing the
nucleotide sequences of mtDNA gene fragment ND2 all samples bees using
DNASTAR software percentages were calculated differences between
Mellipona bicolor and each of the species of the genus Apis -
A.mellifera and A.cerana, which were equal to 22.18% and 23.02%,
respectively. Between A.mellifera and A.cerana percentage difference
was equal to 15.54%. DeSalle et al. (1987) showed in his work for
Drosophila, the differences in the nucleotide sequence of mtDNA 2%
corresponds to the time of divergence of 1 million years, which has
been used in relation to the time of divergence of bees MCArias,
WSSheppard (1996, 2005). Given this divergence, we calculated the rate
of divergence time, which is between Mellipona bicolor and A.mellifera
still 11,090,000. Years between Mellipona bicolor and A.cerana equal to
11.5 million years, and between A.mellifera and is A.cerana 7770000.
years. Forms and A.mellifera A.cerana diverged from Mellipona bicolor
average 11.3 mln. Years ago. Forms and A.mellifera A.cerana, may have
diverged from a common ancestor by an average 3.89 million. Years ago
where A.cerana to 0.42 million. Years earlier separated from a common
ancestor, so A.mellifera is age 3, 47 mln. years and A.cerana - 4,31
Mill. years.
Thus, our studies
have
shown a high degree of genetic relatedness of the Urals and Western
European populations Ammellifera - the only representatives of the
lineage M. shown that the ancestral form of the species Apis mellifera
L. bees may be the evolutionary branch C. The analysis result Ukrainian
bees, confirmed that they belong to subspecies Ammacedonica. Bees
A.cerana A.mellifera and our data are setrinskimi views with respect to
each other. |
013.
Ильясов
Р.А. Дифференциация популяций медоносной пчелы на Урале. Материалы IX
всероссийского популяционного семинара "Особь и популяция –
стратегии
жизни". Уфа. 2006. С. 176-181.
Были
проанализированы образцы пчел из иглинской популяции – 50
семей и
бурзянской популяции – 62 семьи с использованием аллельных
вариаций микросателлитного локуса 4а110. В исследуемых популяциях
наблюдались два аллеля. В бурзянской популяции аллель 1 встречался с
частотой 0,580, а аллель 2 – с частотой 0,420. В иглинской
популяции аллель 1 встречался с частотой 0,710, а аллель 2 –
с
частотой 0,290. Для бурзянской популяции значение коэффициента
инбридинга внутри субпопуляции (Fis) по B.S.Weir, C.C.Cockerham (1984)
равно 0,213, а иглинской популяции - 0,087. Во взятых для сравнения
популяциях Apis mellifera mellifera Colonsay и Whitby в Великобритании,
проанализированных A.B.Jensen et al. (2004) с использованием 11
микросателлитных локусов значение внутрипопуляционного инбридинга (Fis)
было равно 0,003 и 0,024, соответственно. Положительное и близкое к 0
значение этого коэффициента показывает незначительный дефицит
гетерозигот и уровень инбридинга. В бурзянской популяции наблюдаемая
гетерозиготность Hо = 0,387, а ожидаемая гетерозиготность He = 0,609. В
иглинской популяции наблюдаемая гетерозиготность Hо = 0,380, а
ожидаемая гетерозиготность He = 0,416. Как мы видим в бурзянской
популяции, по результатам анализа данного локуса, наблюдается больший
инбридинг и дефицит гетерозигот по сравнению с иглинской популяцией и
популяциями Великобритании, в которых этот коэффициент максимально
приближен к 0, что констатирует минимальное отклонении от равновесия по
Харди-Вайнбергу. В бурзянской популяции это может быть следствием
продолжительной изоляции в горно-лесной географической зоне.
Коэффициент дифференциации популяций (Fst) по B.S.Weir, C.C.Cockerham
(1984) между бурзянской и иглинской популяциями 0,025. Для сравнения,
коэффициент дифференциации популяций (Fst), при анализе с
использованием 11 микросателлитных локусов, между популяциями Apis
mellifera mellifera Colonsay и Whitby Великобритании 0,055. Отсюда
видно, что дифференциация уральских популяций по результатам анализа
данного локуса значительно ниже дифференциации популяций Великобритании
при мультилокусном анализе. Точный тест Фишера (Р), оценивающий генную
дифференциацию между бурзянской и иглинской популяциями P = 0,051, а
величина χ2 = 5,907. Точный тест Фишера (Р), оценивающий
генотипическую дифференциацию между бурзянской и иглинской популяциями
Р = 0,069, а величина χ2 = 5,337. Отсюда можно заключить, что
между
бурзянской и иглинской популяциями наблюдается незначительная
дифференциация на генном и генотипическом уровнях (P ≥ 0,05).
Рассчитанная стандартная генетическая дистанция M.Nei (1972) (Ds) между
иглинской и бурзянской популяциями равна 0,029, а генетическая
дистанция L.L.Cavalli-Sforza, A.W.F.Edwards (1967) (Dce) между
бурзянской и иглинской популяциями была равна 0,086. Для сравнения,
генетическая дистанция M.Nei (1978) расчитанная F.J.Ayala (1975),
используя аллельные вариации 28 кодирующих белок генов, между
локальными популяциями Drosophila willistoni была равна 0,031, между
локальными популяциями рыб - 0,020, между локальными популяциями
беспозвоночных - 0,016. Кроме того, стандартная генетическая дистанция
M.Nei (1978) между островными популяциями Apis mellifera в Германии,
расчитанная P.Neumann et al. (1999), используя 4 микросателлитных
локуса, между матками пчел популяций Baltrum и Langeoog была равна
0,029, а между трутнями - 0,436. Как мы видим, уровень дифференциации
трутней выше уровня дифференциации маток. Генетическая дистанция
L.L.Cavalli-Sforza, A.W.F.Edwards (1967), рассчитанная K.E.Clarke et
al. (2002), используя 6 микросателлитных локусов, между популяциями
Apis mellifera ligustica из Италии и A.m.carnica из Югославии равна
0,510, а между популяциями Apis mellifera ligustica из Италии и Apis
mellifera mellifera из Франции равна 0,680. Таким образом, по данному
локусу уральские популяции различаются между собой, как локальные
популяции, тогда как между европейскими популяциями пчел наблюдаются
большие значения генетического расстояния, что характеризует большую
дифференциацию европейских популяций по сравнению с уральскими.
Таким образом,
была
показана генетическая вариабельность микросателлитного локуса 4а110 в
уральских популяциях и показана дифференциация между иглинской и
бурзянской популяциями. Несмотря на то, что наблюдаются четкие различия
на уровне митохондриальной (локус COI-COII) и ядерной ДНК
(микросателлитный локус 4а110), все же уровень дифференциации между
уральскими популяциями низок. Такая незначительная дифференциация между
гибридной и местной популяциями, по результатам анализа с
использованием одного микросателлитного локуса 4а110, может иметь
несколько объяснений. Во-первых, возможно, что это результат потока
генов из бурзянской популяции в иглинскую. Во-вторых, возможно, что
частота аллелей этого локуса в иглинской популяции не сильно изменилась
в результате гибридизации с Apis mellifera caucasica. В-третьих, один
локус не всегда может быть адекватным в изучении и сравнении популяций.
Дальнейшая наша задача – проанализировать уральские популяции
и
популяции пчел прилежащих регионов с использованием большего количества
ДНК маркеров.
We analyzed
samples of
bees from Iglinsky population - 50 families and Burzyan population - 62
families with allelic variations of microsatellite loci 4a110. The
study populations were observed two alleles. In Burzyan population
allele frequency of 1 met with 0,580, and allele 2 - with the frequency
of 0.420. In Iglinsky population allele frequency of 1 met with 0.710,
and allele 2 - with the frequency of 0.290. For Burzyan population
coefficient of inbreeding within the subpopulation (Fis) for BSWeir,
CCCockerham (1984) is equal to 0.213, and Iglinsky population - 0,087.
When taken to compare populations Apis mellifera mellifera Colonsay and
Whitby in the UK, analyzed ABJensen et al. (2004) using 11
microsatellite loci value intrapopulation inbreeding (Fis) was equal to
0.003 and 0.024, respectively. Positive and close to 0 value of this
index shows a slight deficit of heterozygotes and the level of
inbreeding. In Burzyan population observed heterozygosity = 0.387 But,
as expected heterozygosity He = 0,609. In Iglinsky population observed
heterozygosity = 0.380 But, as expected heterozygosity He = 0,416. As
we see in Burzyan population, according to the analysis of this locus,
there is a greater inbreeding and a lack of heterozygotes compared with
Iglinsky populations and populations of the UK, where this ratio is as
close to 0, which establishes the minimum deviation from equilibrium of
Hardy-Weinberg equilibrium. In Burzyan population this may be due to
prolonged isolation in the mountain forest geographical area.
Coefficient of population differentiation (Fst) of BSWeir, CCCockerham
(1984) Burzyan between 0,025 and Iglinsky populations. For comparison,
the coefficient of population differentiation (Fst), when analyzed
using 11 microsatellite loci between populations Apis mellifera
mellifera Colonsay and Whitby UK 0,055. This shows that the
differentiation of the Ural population according to the analysis of the
locus of much lower differentiation of populations in the UK multipoint
analysis. Fisher's exact test (P), estimating genetic differentiation
between populations Iglinsky Burzyan and P = 0,051, and the value of
χ2 = 5,907. Fisher's exact test (P), estimating genotypic
differentiation between populations Iglinsky Burzyan and P = 0.069, and
the value of χ2 = 5,337. From this we can conclude that between
Burzyan and Iglinsky populations observed slight differentiation at the
genetic and genotypic levels (P ≥ 0,05). The standard genetic
distance M.Nei (1972) (Ds) between Iglinsky and Burzyan populations is
0.029 and the genetic distance LLCavalli-Sforza, AWFEdwards (1967)
(Dce) between Burzyan and Iglinsky populations was equal to 0.086. For
comparison, the genetic distance M.Nei (1978) calculate FJAyala (1975),
using the allelic variations of 28 protein-coding genes between local
populations of Drosophila willistoni was equal to 0.031, between local
populations of fish - 0,020 between local populations of invertebrates
- 0,016. In addition, the standard genetic distance M.Nei (1978) among
island populations of Apis mellifera in Germany calculate P.Neumann et
al. (1999), using four microsatellite loci between populations of bees
queens Baltrum and Langeoog was equal to 0.029, but between drones -
0.436. As we can see, the level of differentiation of drones above the
differentiation of queens. Genetic distance LLCavalli-Sforza,
AWFEdwards (1967), calculated KEClarke et al. (2002), using 6
microsatellite loci between populations Apis mellifera ligustica from
Italy and from Yugoslavia Amcarnica equal to 0.510, and between the
populations of Apis mellifera ligustica from Italy and Apis mellifera
mellifera from France is 0.680. Thus, according to the locus of the
Ural population differ among themselves as local populations, whereas
between the populations of European bee observed large genetic distance
values that characterizes the greater differentiation European
populations compared with Ural.
Thus, the genetic
variability has been shown 4a110 microsatellite loci in the Ural
population and shows the differentiation between Iglinsky and Burzyan
populations. Despite the fact that there are clear differences in the
level of mitochondrial (locus COI-COII) and nuclear DNA (microsatellite
loci 4a110), yet the level of differentiation between the Ural
population is low. This slight differentiation between hybrid and local
populations, according to the analysis using one microsatellite locus
4a110 may have several explanations. Firstly, it is possible that this
is the result of gene flow from Burzyan population Iglinskiy. Secondly,
it is possible that the frequency of alleles at this locus in Iglinsky
population has not changed much as a result of hybridization Apis
mellifera caucasica. Third, one locus may not always be adequate in the
study and compared populations. Further, our task - to analyze the Ural
population and the population of bees surrounding regions using more
DNA markers. |
012.
Ильясов
Р.А. Полиморфизм Apis mellifera mellifera L на Урале. Диссертация на
соискание ученой степени кандидата биологических наук.
Уфа. 2006. С. 204.
Полиморфизм
Apis mellifera mellifera L на Урале. Диссертация (Polymorphism of Apis
mellifera mellifera L. in Ural. Thesis of Ph.D). The thesis for the
degree of candidate of biological sciences. Preservation of the gene
pool of dark forest honey bee Ammellifera is the base point for the
development of beekeeping and bee breeding in Russia which in turn
requires solving a number of problems in basic and applied research.
Our work touches the three of them. We were able to prove the existence
of the Urals several genetic reserves that should be the basis for the
preservation of the gene pool Ammellifera. It was expanded set of
genetic markers and statistical approaches used for this purpose. We It
managed to obtain new data on the structure of intra honeybee
A.mellifera. We hope that the results will allow to approach the
problem of preserving the gene pool Ammellifera both in Russia and in
other Nordic countries. As is known, the use morphometric methods for
this purpose little information when using hybrid bees. It is shown
that by using molecular methods may determine which subspecies belong
to the bees. However, not all genetic loci can become markers. Only
strict selection and integrated use of nuclear loci and mitochondrial
genomes will be effective in the identification of subtypes of bees.
Equally important in the study played a statistical analysis of
results. Statistical methods, selection of genetic markers and the
character of the collection object is strictly dependent on the goals
of the study. Phylogenetic analysis also allowed for the first time to
establish close genetic kinship bees Ural and European populations
Ammellifera. In parallel, we have been able to show that the
evolutionary branch of M consists only of subspecies Ammellifera,
whereas previously it was thought that it includes several other
A.mellifera subspecies of the North-West Africa and the Iberian
Peninsula. The obtained genetic characteristics of populations of bees
Urals unique and will serve as a basis for further research, as well as
measures for the conservation and restoration of the entire gene pool
Ammellifera the territory of the former habitat subspecies.
Furthermore, based on these data, we can develop a strategy for the
further development and management of beekeeping Ammellifera
populations in Russia and Europe. On the basis of polymorphism
intergenic locus COI-COII mitochondrial DNA demonstrated the existence
of at least four stored locally populations of Apis mellifera mellifera
L. in the Urals: Vishera, Kama region of the South, tatyshlinskoy and
Burzyan. An analysis of the frequency of occurrence of combinations of
PQQ intergenic locus COI-COII mtDNA showed that uinskaya population,
previously hosted by morphometric featured for the population
Ammellifera, it is a hybrid. Genetic distance Ammellifera between the
Ural and the hybrid population can be Iglinsky accepted for further
studies at one of the criteria for the safety of aboriginal population
A.m.mellifera. A study of polymorphism loci separate nuclear and
mitochondrial DNA revealed a close genetic relationship, a small
fraction of inbreeding and a lack of heterozygotes in the Ural
population Ammellifera. Phylogenetic analysis based on a comparison of
the nucleotide ND2 gene fragment sequences of mitochondrial DNA
revealed genetic kinship of the Ural and Western European populations
Ammellifera. Comparative analysis mitotypes gene fragment of the
mitochondrial ND2 DNA shows that subspecies Ammellifera, probably the
only Representative intraspecific evolutionary branches of M, which is
thus not It should include not only the African subspecies Apis
mellifera sahariensis Baldensperger and Apis mellifera intermissa Maa,
but Spanish subspecies of Apis mellifera iberica Goetze. It found that
species ancestral form Apis mellifera L., could be With bee
evolutionary branch, and not, as previously thought.
Диссертация на соискание ученой степени кандидата биологических наук.
Сохранение генофонда тёмной лесной медоносной пчелы A.m.mellifera
являлось базовым моментом для развития пчеловодства и селекции пчел в
России, что в свою очередь требует решения целого ряда задач в области
фундаментальных и прикладных исследований. Наша работа касалась трёх из
них. Нам удалось доказать существование на Урале нескольких
генетических резерватов, которые должны стать основой для сохранения
генофонда A.m.mellifera. Был расширен комплекс генетических маркёров и
статистических подходов, используемых для этого. Нам удалось получить
новые данные по внутривидовой структуре медоносной пчелы A.mellifera.
Мы надеемся, что полученные результаты позволят приблизиться к решению
проблемы сохранения генофонда A.m.mellifera как в России, так и в
других странах Северной Европы. Как известно, использование
морфометрических методов для этой цели малоинформативно при работе с
гибридными пчелами. Показано, что с помощью молекулярных методов
возможно определить, к какому подвиду принадлежат пчелы. Тем не менее,
не любые локусы могут стать генетическими маркерами. Только строгий
подбор и комплексное использование локусов ядерного и митохондриального
геномов будет эффективно в идентификации подвидов пчел. Не менее важную
роль в исследовании играла статистическая обработка полученных
результатов. Методы статистической обработки, подбор генетических
маркеров и характер сбора объекта строго зависят от поставленных целей
исследования. Также филогенетический анализ позволил впервые установить
тесное генетическое родство пчел уральских и европейских популяций
A.m.mellifera. Параллельно мы смогли показать, что эволюционная ветвь М
состоит только из подвида A.m.mellifera, тогда как раньше считалось,
что в нее входят несколько других подвидов A.mellifera из
Северо-Западной Африки и Иберийского полуострова. Полученные нами
генетические характеристики популяций пчел Урала уникальны и будут
служить основой для дальнейших исследований, а также мероприятий по
сохранению и восстановлению генофонда A.m.mellifera на всей территории
прежнего ареала подвида. Кроме того, на основе этих данных мы можем
разработать стратегию дальнейшего развития пчеловодства и управления
популяциями A.m.mellifera в России и Европе. На основе полиморфизма
межгенного локуса COI-COII митохондриальной ДНК показано существование
как минимум четырёх сохранившихся локальных популяций Apis mellifera
mellifera L. на Урале: вишерской, южно-прикамской, татышлинской и
бурзянской. Анализ частот встречаемости комбинации PQQ межгенного
локуса COI-COII мтДНК показал, что уинская популяция, ранее принимаемая
по морфометрическим признакам за популяцию A.m.mellifera, являлась
гибридной. Генетическое расстояние между уральской A.m.mellifera и
гибридной иглинской популяцией может быть принято в дальнейших
исследованиях за один из критериев сохранности аборигенной популяции
A.m.mellifera. Исследование полиморфизма отдельных локусов ядерной и
митохондриальной ДНК выявило тесное генетическое родство, небольшую
долю инбридинга и дефицит гетерозигот в уральских популяциях
A.m.mellifera. Филогенетический анализ на основе сравнения нуклеотидных
последовательностей фрагмента гена ND2 митохондриальной ДНК показал
генетическое родство уральских и западноевропейских популяций
A.m.mellifera. Сравнительный анализ митотипов фрагмента гена ND2
митохондриальной ДНК свидетельствует, что подвид A.m.mellifera,
вероятно, является единственным представителем внутривидовой
эволюционной ветви М, в которую, таким образом, не следует включать не
только африканские подвиды Apis mellifera sahariensis Baldensperger и
Apis mellifera intermissa Maa, но и испанский подвид Apis mellifera
iberica Goetze. Обнаружено, что предковой формой вида Apis mellifera
L., могли быть пчелы эволюционной ветви С, а не О, как считалось ранее.
Publication Name: Ilyasov R.A. Polymorphism of Apis mellifera mellifera
L. in Ural. Thesis of Ph.D. 2006. 204 p. |
011.
Ильясов
Р.А. Полиморфизм Apis mellifera mellifera L на Урале. Автореферат
диссертации на соискание ученой степени кандидата биологических наук.
Уфа. 2006. С. 24.
ПОЛИМОРФИЗМ APIS MELLIFERA
MELLIFERA L. НА УРАЛЕ (Polymorphism of Apis mellifera mellifera L. in
Ural. Thesis of Ph.D. )
Было показано
существование четырёх сохранившихся
локальных
популяций
A.m.mellifera на Урале на основе полиморфизма межгенного локуса
COI-COII мтДНК. Одновременно установлено, что уинская популяция, ранее
принимаемая по морфометрическим признакам за популяцию
A.m.mellifera,
является
гибридной. Анализ генетической структуры уральских популяций
A.m.mellifera на основе полиморфизма ядерной и митохондриальной ДНК
выявил тесное генетическое родство, небольшую долю инбридинга и дефицит
гетерозигот.
Таким образом,
было
показано, что A.m.mellifera на Урале существует в виде островной
генетически неподразделённой популяции. Кроме того, показано
генетическое родство уральских и западноевропейских популяций
A.m.mellifera. Сравнительным анализом митотипов фрагмента гена ND2
митохондриальной ДНК показано, что подвид A.m.mellifera, вероятно,
является
единственным
представителем внутривидовой эволюционной ветви М, а предковой формой
вида Apis mellifera L. могли быть пчелы эволюционной ветви С.
1.
На
основе полиморфизма межгенного локуса COI-COII митохондриальной ДНК
показано существование как минимум четырёх сохранившихся локальных
популяций Apis mellifera mellifera L. на Урале: вишерской,
южно-прикамской, татышлинской и бурзянской.
2.
Анализ частот встречаемости комбинации PQQ межгенного локуса COI-COII
мтДНК показал, что уинская популяция, ранее принимаемая по
морфометрическим признакам за популяцию A.m.mellifera, является
гибридной. Генетическое расстояние между уральской A.m.mellifera и
гибридной иглинской популяцией может быть принято в дальнейших
исследованиях за один из критериев сохранности аборигенной популяции
A.m.mellifera.
3.
Исследование полиморфизма отдельных локусов ядерной и митохондриальной
ДНК выявило тесное генетическое родство, небольшую долю инбридинга и
дефицит гетерозигот в уральских популяциях A.m.mellifera.
4.
Филогенетический анализ на основе сравнения нуклеотидных
последовательностей фрагмента гена ND2 митохондриальной ДНК показал
генетическое родство уральских и западноевропейских популяций
A.m.mellifera.
5.
Сравнительный анализ митотипов фрагмента гена ND2 митохондриальной ДНК
свидетельствует, что подвид A.m.mellifera, вероятно, является
единственным представителем внутривидовой эволюционной ветви М, в
которую, таким образом, не следует включать не только африканские
подвиды Apis mellifera sahariensis Baldensperger и Apis mellifera
intermissa Maa, но и испанский подвид Apis mellifera iberica Goetze.
Обнаружено, что предковой формой вида Apis mellifera L., могли быть
пчелы эволюционной ветви С, а не О, как считалось ранее.
It has been shown
the existence of four surviving
Ammellifera local
populations in the Urals-based polymorphism intergenic locus COI-COII
mtDNA. At the same time found that Uinskoye population, previously
hosted on morphometric characteristics of the population
Ammellifera, is a
hybrid. Analysis of the genetic structure of populations of the Ural
Ammellifera based polymorphism nuclear and mitochondrial DNA revealed a
close genetic relationship, a small fraction of inbreeding and the
deficit of heterozygotes.
Thus, it was
shown that
the Ural Ammellifera exists as a genetically nepodrazdelёnnoy island
population. Moreover, we show the genetic relationship of the Urals and
Western European populations Ammellifera. Comparative analysis of gene
fragment mitotypes ND2 mitochondrial DNA shows that subspecies
Ammellifera, probably the
the sole
representative
of intraspecific evolutionary branch of M, and the ancestral form
species Apis mellifera L. bees could be evolutionary branch S.
1. On the basis
of
polymorphism of the intergenic locus COI-COII mitochondrial DNA
demonstrated the existence of at least four remaining local populations
of Apis mellifera mellifera L. in the Urals: Visherskaya, South-Kama
region, and tatyshlinskoy Burzyan.
2. Analysis of
the
frequency of occurrence of a combination of PQQ intergenic locus
COI-COII mtDNA showed that Uinskoye population, previously hosted on
morphometric characteristics of the population Ammellifera, is a
hybrid. The genetic distance between the Urals and Ammellifera Iglinsky
hybrid population can be made for further research in one of the
criteria for the preservation of native populations Ammellifera.
3. A study of
polymorphism loci separate nuclear and mitochondrial DNA revealed a
close genetic relationship, a small fraction of inbreeding and the
deficit of heterozygotes in the Urals populations Ammellifera.
4. Phylogenetic
analysis
based on a comparison of the nucleotide sequences of the gene fragment
ND2 mitochondrial DNA showed genetic relatedness of the Urals and
Western European populations Ammellifera.
5. Comparative
analysis
mitotypes ND2 gene fragment of mitochondrial DNA indicates that the
subspecies Ammellifera, probably, is the only representative of
intraspecific evolutionary branches of M, which, therefore, should not
be included not only African subspecies Apis mellifera sahariensis
Baldensperger and Apis mellifera intermissa Maa, but Spanish subspecies
Apis mellifera iberica Goetze. It was found that the ancestral form of
the type Apis mellifera L., could be an evolutionary branch with bees,
and not, as previously thought.
Publication Name:
Ilyasov R.A. Polymorphism of Apis mellifera mellifera L. in Ural.
Thesis of Ph.D. 2006. 24 p. |
010.
Ильясов Р.А.,
ПетуховА.В., ПоскряковА.В., НиколенкоА.Г. На Урале сохранились четыре
резервата пчелы среднерусской расы Apis mellifera mellifera L..
Пчеловодство. 2006. №2. С. 19.
На
Урале сохранились четыре резервата пчелы среднерусской расы Apis
mellifera mellifera L. (In the Urals preserved four population of dark
european bee Apis mellifera mellifera L.)
Обнаруженные нами
пасеки
с высокой частотой аллеля PQQ позволяют говорить о существовании на
Урале, как минимум, четырех локальных популяций А. т. mellifera L.:
вишерской, южно-прикамской, татышлинской и бурзян- ской. Принадлежность
пчел уинской популяции к подвиду А. т. mellifera L. не подтвердилась.
Данное утверждение объясняется тем, что либо предварительные
морфометрические исследования не позволяли с большой точностью
идентифицировать подвиды, что не удивительно при современном уровне
гибридизации, либо популяция подверглась гибридизации за время,
прошедшее между двумя исследованиями. Найденные нами пасеки с высоким
содержанием аллеля PQQ на территории Татышлинского района Республики
Башкортостан, — возможно, сохранившаяся часть некогда
знаменитой
янаульской популяции А. т. mellifera. L.
Таким образом, в
ходе
популяционно-генетических исследований на Южном и Среднем Урале
обнаружены четыре локальные популяции, которые можно охарактеризовать
как генетические резерваты А. т. mellifera. L. Это вишерская,
южно-прикам- ская, татышлинская и бурзянская популяции, отличающиеся
высокой долей встречаемости аллеля PQQ локуса COI-COII мтДНК. В
настоящее время наша лаборатория проводит сравнительные
популяционно-генетические исследования выделенных популяций.
We found an
apiary with
a high frequency of allele PQQ suggest the existence of the Urals, at
least four local populations of A. m. Mellifera L .: Visherskaya,
South-Kama region, and tatyshlinskoy burzyan- tion. Affiliation bees
Uinskoye population to the subspecies A. m. Mellifera L. was not
confirmed. This statement is explained by the fact that a preliminary
morphometric study did not allow a high degree of accuracy to identify
subspecies, which is not surprising given the present level of
hybridization, or the population has undergone hybridization for the
time elapsed between the two studies. We found apiary with high allele
PQQ in the territory of the Republic of Bashkortostan Tatyshlinsky
District - perhaps remains of the once famous YANAULSKY population of
A. m. Mellifera. L.
Thus, in the
course of
population genetic studies in the South and Middle Urals found four
local populations, which can be described as genetic reserves A. m.
Mellifera. L. This Visherskaya, South prikam- Skye, tatyshlinskaya and
Burzyan population, a high proportion allele PQQ locus COI-COII mtDNA.
Currently, our laboratory conducts comparative population genetic
studies of populations isolated.
Publication Name:
Ilyasov R.A., Petukhov A.V., Poskryakov A.V. Nikolenko A.G. In the
Urals preserved four population of dark european bee Apis mellifera
mellifera L. Russian journal of beekeeping. 2006. V. 2. P. 19-20. |
009.
Ильясов Р.А.,
Поскряков А.В., Николенко А.Г. Митохондриальная ДНК в изучении
популяций пчел на Урале. Материалы межрегионального совещания
энтомологов Сибири и Дальнего Востока. Новосибирск. 2006. С. 72-74.
На
текущий момент
подвиды подвержены интенсивной гибридизации, чего не избежала и
популяция A.m.mellifera – основной компонент эволюционной
ветви
М. На основе определения частоты элемента PQQ межгенного локуса
COI-COII мтДНК в популяциях пчел на Урале (Средний и Южный Урал) нами
было обнаружено четыре резервата пчелы подвида A.m.mellifera
–
часть некогда единой европейской популяции A.m.mellifera, занимающая
ареал от Западной Европы до Уральских гор и представляющая большую
ценность для пчеловодства Северной Евразии (Ильясов, 2005).
Анализ
нуклеотидной
последовательности части гена Nd2 протяженностью 612-633 п.н. в 12
образцах четырех выделенных нами популяций показал незначительную
дивергенцию, что подтверждает единство происхождения и родство.
Проанализированные нуклеотидные последовательности гена Nd2 пчел
уральской популяции были депонированны в генбанк
(http://www.ncbi.nlm.nih.gov) под номерами DQ181611-DQ181622. Между
нуклеотидными последовательностями гена Nd2 проанализированных образцов
наблюдаются транзиции в положениях 35, 120, 360, 514, 546, где
транзиция Т>С в положении 35 в образцах DQ181614 и DQ181618
приводит
к аминокислотной замене изолейцина Ile на треонин Thr в положении 12.
Трансверсий в последовательностях не было обнаружено.
Сравнение
проанализированной нами последовательности гена Nd2 уральских образцов
с аналогичными последовательностями образцов A.m.mellifera европейских
популяций, а также других подвидов A.mellifera (Arias and Sheppard,
1996 - U35743-U35765; Marino et al., 2002 - AY114484- AY136625;
Sheppard and Meixner, 2003 - AY136624 - AY136625; Kandemir et al., 2004
- AY618910 - AY618911, AY618919 - AY618920) показало значительное
сходство пчел уральской популяции с A.m.mellifera европейских популяций
по сравнению с популяциями пчел других подвидов, что доказывает их
единство происхождения. При кластерном анализе, используя метод
ближнего соседа, наблюдается разделение на три крупные ветви, которые
по составу и географическому положению ареалов подвидов соответствовали
эволюционным ветвям А, М и С (рис. 1). Ветвь О объединилась с
африканской ветвью А, что можно объяснить сильным потоком генов со
стороны ветви А. Такая группировка согласуется с результатами
предыдущих исследований F.Ruttner (1988), M.C.Arias and W.S.Sheppard
(1996), P.Franck et al. (2000) и A.Jensen et al. (2005).
Ветвь А
подразделяется
на две группы – северо- и южно-африканскую. Такое разделение
было
вызвано, возможно, географическим барьером, как пустыня Сахара, что
привело к длительной изоляции и последующей дивергенции подвидов. Самое
большое таксономическое разнообразие наблюдается в ветви С, куда вошли
образцы нового подвида A.m.pomonella, что позволяет предположить, что
ветвь С была предковой для всех эволюционных ветвей. Ветвь М включает
подвиды A.m.ligustica и A.m.sicula, гибридизация которых с
A.m.mellifera была показана в работе P.Franck et al. (2000). Образцы
A.m.meda входят в группы С и О, а образцы A.m.lamarckii – в
группы О и А, что отметили M.C.Arias and W.S.Sheppard (1996) и P.Franck
et al. (2000, 2001). Такое распределение подвидов говорит о зонах
гибридизации на границах эволюционных ветвей С и О, А и О,
соответственно.
Таким образом, на
Урале
еще сохранилась часть уникальной европейской популяции A.m.mellifera,
которая подразделена на четыре субпопуляции, характеризующиеся
значительным сходством по материнской линии мтДНК с европейскими
популяциями A.m.mellifera. Для успешного сохранения генофонда
A.m.mellifera и восстановления его первоначального ареала на Урале
необходимо провести более детальное исследование популяций данного
региона и обозначить границы резерватов.
To date, the
subspecies
susceptible to intense hybridization, which was not spared and the
population Ammellifera - the main component of the evolutionary branch
of M. On the basis of determining the frequency of the element PQQ
intergenic locus COI-COII mtDNA in populations of bees in the Urals
(Middle and South Urals), we have found four reserve bee subspecies
Ammellifera - once part of a single European populations Ammellifera,
occupying the area from Western Europe to the Ural Mountains and
represents great value for beekeeping in North Eurasia (Ilyasov, 2005).
Nucleotide
sequence
analysis of the gene Nd2 length 612-633 bp 12 samples of four isolated
populations showed us a small divergence, which confirms the common
origin and kinship. Analyzed the nucleotide sequence of the gene Nd2
bees Ural population was deposited into the genebank
(http://www.ncbi.nlm.nih.gov) under the numbers DQ181611-DQ181622.
Between the nucleotide sequences of the gene analyzed samples Nd2
transitions observed at positions 35, 120, 360, 514, 546, where the
transitions T> C at position 35 in the samples DQ181614 and
DQ181618
causes an amino acid substitution of isoleucine for threonine Thr Ile
at position 12 in the sequence transversions It was observed.
Comparison of
gene
sequences we analyzed Nd2 Ural samples with similar sequences of
samples Ammellifera European populations, as well as other subspecies
A.mellifera (Arias and Sheppard, 1996 - U35743-U35765; Marino et al.,
2002 - AY114484- AY136625; Sheppard and Meixner, 2003 - AY136624 -
AY136625; Kandemir et al., 2004 - AY618910 - AY618911, AY618919 -
AY618920) showed significant similarity to the Ural population of bees
Ammellifera European population compared with the populations of other
subspecies of bees, which proves their common origin. When a cluster
analysis using the nearest-neighbor method, there is a division into
three major branches which the composition and geographical location of
areas consistent with an evolutionary subspecies branches A, M and C
(Fig. 1). About Branch merged with the African branch A, which can be
explained by a strong gene flow from the branch A. Such a grouping is
consistent with results of previous studies F.Ruttner (1988), MCArias
and WSSheppard (1996), P.Franck et al. (2000) and A.Jensen et al.
(2005).
A branch is
divided into
two groups - the North and South Africa. This separation was caused,
perhaps, geographic barriers like the Sahara desert, which led to a
long isolation and subsequent divergence subspecies. The greatest
taxonomic diversity observed in the branch C, which includes samples of
the new subspecies Ampomonella, suggesting that was the ancestral
branch with all evolutionary branches. Branch M includes subspecies and
Amligustica Amsicula, hybridization with Ammellifera which was shown in
the P.Franck et al. (2000). Samples Ammeda come in groups C and D, and
samples Amlamarckii - in group G and A, which noted MCArias and
WSSheppard (1996) and P.Franck et al. (2000, 2001). This distribution
suggests subspecies hybridization areas on the borders of evolutionary
branches C and D, A and D, respectively.
Thus, in the
Urals, it
has preserved a unique part of the European population Ammellifera,
which is divided into four sub-population, characterized by
considerable similarity maternal mtDNA European populations
Ammellifera. In order to successfully preserve the gene pool
Ammellifera and restore its original habitat in the Urals is necessary
to conduct a more detailed study of the populations of the region and
demarcate reserves. |
008.
Ильясов
Р.А., Поскряков А.В. Филогенетика подвидов Apis mellifera.
Пчеловодство. 2006. №7. С. 18-19.
Филогенетика подвидов Apis
mellifera (Phylogenetics of subspecies of Apis mellifera)
современные
филогенетические исследования проводят с использованием как
морфологических, так и молекулярно-генетических методов. Схемы родства
подвидов, построенные на основе использования разных методов, имеют
определенную степень сходства в числе групп, однако часто возникают
разногласия по вопросу состава каждой. Возможно, это следствие разной
эволюционной значимости и коэффициента отбора локусов и выборки
образцов, которые могли оказаться гибридными. Филогенетика пчел только
начинает развиваться и сейчас представляет безграничное поле для
дальнейших исследований. Конечная картина филогенетических отношений
подвидов пчел должна получиться только на основе совокупного анализа
всех накопленных за продолжительный период материалов по данной теме.
modern
phylogenetic
studies carried out using both morphological and molecular genetic
methods. Scheme kinship subspecies that are based on the use of
different methods, have a certain degree of similarity among the
groups, but often there is disagreement on the issue of the composition
of each. Perhaps this is a consequence of different evolutionary
significance and coefficient selection and sampling of loci that could
be hybrid. Phylogenetics bees just beginning to develop, and now is a
boundless field for further research. The final picture of the
phylogenetic relationships subspecies of bees should be obtained only
on the basis of cumulative analysis of all accumulated over a long
period of material on the subject.
Publication Name:
Ilyasov R.A., Poskryakov A.V. Phylogenetics of subspecies of Apis
mellifera. Russian journal of Russian journal of beekeeping. 2006. V.7.
P. 18-19. |
007.
Ilyasov R.A.,
Komissar A.D., Baymiev A.K., Poskryakov A.V., Nikolenko A.G.
Phylogenetics researches in Apis mellifera macedonica concluded from
mitochondrial DNA sequence. GenBank. 2006. accession numbers
DQ361088-DQ361090 (http://www.ncbi.nlm.nih.gov).
Apis mellifera
macedonica 98 colony NADH dehydrogenase subunit 2 (ND2) gene, partial
cds; mitochondrial
GenBank:
DQ361088.1
FASTA Graphics
Go to:
LOCUS
DQ361088
617 bp
DNA linear
INV 08-FEB-2006
DEFINITION
Apis mellifera macedonica 98 colony NADH dehydrogenase subunit 2
(ND2) gene, partial cds; mitochondrial.
ACCESSION
DQ361088
VERSION
DQ361088.1 GI:86440158
KEYWORDS
.
SOURCE
mitochondrion Apis mellifera macedonica
ORGANISM Apis mellifera macedonica
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
Aculeata; Apoidea; Apidae; Apis.
REFERENCE
1 (bases 1 to 617)
AUTHORS Ilyasov,R.A., Komissar,A.D., Baymiev,A.K.,
Poskryakov,A.V. and
Nikolenko,A.G.
TITLE Phylogenetics researches
in Apis mellifera macedonica concluded
from mitochondrial DNA sequence
JOURNAL Unpublished
REFERENCE
2 (bases 1 to 617)
AUTHORS Ilyasov,R.A., Komissar,A.D., Baymiev,A.K.,
Poskryakov,A.V. and
Nikolenko,A.G.
TITLE Direct Submission
JOURNAL Submitted (13-JAN-2006) Russian Academy of
Sciences, Ufa Scientific
Center, Institute of Biochemistry and Genetics, Prospect Octyabrya,
71, Ufa 450054, Russia
FEATURES
Location/Qualifiers
source
1..617
/organism="Apis mellifera macedonica"
/organelle="mitochondrion"
/mol_type="genomic DNA"
/isolation_source="98 colony; apiary of A.D. Komissar"
/sub_species="macedonica"
/db_xref="taxon:200410"
/sex="worker"
/tissue_type="thorax"
/dev_stage="adult"
/country="Ukraine: Kiev"
gene
1..>617
/gene="ND2"
CDS
1..>617
/gene="ND2"
/codon_start=1
/transl_table=5
/product="NADH dehydrogenase subunit 2"
/protein_id="ABC95998.1"
/db_xref="GI:86440159"
/translation="MFFMNFKYHWFIYLLITIFVLMMNSNNIFIQWMLMEFGTIISIS
LINIKSTNKTPSLIYYSVSVISSIFLFFMIIVYLSSISFTKTDTFNFMVQMMFFLKIG
TFPFHFWMIYSYEMMNWKQIFLMSTLIKFIPIYMMVSMTKINSWTLYFLITNSLYISF
YANKFYTLKKLLACSTIFNSFYFIFILELNKNMFIAMIILYSFNY"
ORIGIN
1 atcttcttca taaattttaa ataccactga tttatttatc ttttaattac tatttttgta
61 ttaataataa attccaataa tatttttatt caatgaatat taatagaatt tggtacaatc
121 attagaatta gattaattaa tattaaatcc acaaataaaa ccccaagatt aatttattat
181 tcagtatcag taatttcaag aattttttta ttctttataa ttattgtata cttatcatcc
241 attagattta ctaaaacaga tacttttaat tttatagttc aaataatatt ttttttaaaa
301 attggaactt tcccctttca tttttgaata atttattctt atgaaataat aaattgaaag
361 caaatttttt taatatcaac attaattaaa tttattccaa tttatataat agtttcaata
421 actaaaatta attcatgaac attatatttt ttaattacaa atagattata tatttcattt
481 tatgctaata aattttacac tctaaaaaaa ttactagcat gttcaacaat ttttaattca
541 ttctatttta tttttatttt agaattaaat aaaaatatat ttattgctat aattatttta
601 tattcattta attattt
// |
006.
Ильясов
Р.А. Полиморфизм локуса COI-COII мтДНК медоносной пчелы среднерусской
расы Apis mellifera mellifera L. на Урале. Материалы III конкурса
научных работ молодых ученых и аспирантов УНЦ РАН и АН РБ. Уфа. 2005.
С. 74-76.
Естественный
ареал медоносной пчелы Apis mellifera L [Скориков, 1936] охватывает
значительную часть Старого Света: Африку, Ближний Восток и всю Европу
до Уральских гор. В пределах этого ареала вид Apis mellifera
подразделяется на 24 географические расы [Ruttner, 1988]. Только
среднерусская раса Apis mellifera mellifera освоила огромную территорию
вдоль северной границы видового ареала. Эта территория протянулась
вдоль лесной и лесостепной зон через всю Европу [Николенко, 2002]. С
расширением ареала Apis mellifera mellifera происходит усиление расовой
дифференциации и усложнение генетической структуры популяции пчелы
среднерусской расы [Гранкин, 1998]. Закономерности географической и
клинальной изменчивости пчел среднерусской расы изучали А.С.Михайлов
(1930), А.С.Скориков (1936),В.В.Алиатов (1948). Однако только
клинальный характер изменения морфометрических признаков не может
объяснить всю сложность структуры популяции пчелы среднерусской расы.
Такая недостаточная изученность пчел Урала представляет интерес для
дальнейших исследований.
За последние два
века
ареал А. т. mellifera существенно сократился из-за гибридизации с
другими расами A. mellifera. Благодаря деятельности человека гибридные
формы пчел получили широкое распространение, что существенно снизило
уровень адаптированности популяций к окружающей среде [Черевко, 1995].
В настоящее время по всему ареалу пчелы среднерусской расы преобладают
гибриды разных поколений. Россия, вероятно, еще облада- етрезервами для
восстановления генофонда^. т. mellifera. Г 1о данным В.1 1.Сат- тарова
(2000) и А.В.Петухова (1996), на Урале еще сохранились локальные
популяции пчелы среднерусской расы. Освоение огромных медоносных
ресурсов России, расположенных в центральных и северных районах
европейской части страны, невозможно без использования генофонда самой
зимостойкой из всех рас пчел - среднерусской [Гранкин, 1997].
Среднерусские пчелы незаменимы в северных европейских районах ее
ареала, на Урале и в Сибири, где сосредоточены основные медовые запасы
России [Гранкин, 1998].
Среди локальных
популяций среднерусских пчел наиболее известны башкирские, алтайские и
полесские [Билаш, 1991]. Фактические данные о состоянии генофонда
башкирской популяции медоносной пчелы в последнее десятилетие не
публиковались [Николенко, 2002]. Медоносная пчела среднерусской расы
все еще ост ае тся малоизученным объектом. В частности, это относится к
пчеле Пермской области, территория которой расположена на северной
границе естественного ареала медоносной пчелы [Петухов и др., 1996].
Было
проанализировано
268 особей пчел из 134 семей в 7 районах Пермской области, где материал
собирался совместно с преподавателем ПГПУ А.В.Петухо- вым и 730 особей
пчел из 365 семей в 3 районах Республики Башкортостан (Та- тышлинский,
Ипшнский и Бурзянский). По подсчетам частот встречаемости аллелей
выделили районы, ще доля аллеля PQQ выше 0,9. В Пермской области вьще-
лили две такие популяции - Вишерская, куда входят пасеки
Красновишерского района, и Южная прикамская популяция, куда входят
пасеки Ординского, Частин- ского, Нытвенского, Пермского, Осинского
районов. В Уинском районе, в отличие от результатов А.В.Пстухова, доля
аллеля PQQ меньше 0,9. В Республике Башкортостан была выделена
Татышлинская популяция, куда входят пасеки Та- тышлинского района.
Повторно подтвердилась принадлежность Бурзянской популяции к
среднерусской расе. В Hi линском районе доля аллеля PQQ меньше 0,9.
Таким образом, на
Урале
выделены четыре сохранившиеся локальные популяции медоносной пчелы
среднерусской расы, которые в дальнейшем будут объявлены как
генетические резерваты.
The natural
habitat of
the honey bee Apis mellifera L [Skorikov 1936] covers a large part of
the Old World: Africa, the Middle East and the whole of Europe to the
Ural Mountains. Within this area kind of Apis mellifera is divided into
24 geographical races [Ruttner, 1988]. Only the Central Russian race
Apis mellifera mellifera has mastered a vast territory along the
northern border of the species area. This area stretches along the
forest and steppe zones across Europe [Nikolenko, 2002]. With the
expansion of the range Apis mellifera mellifera is a strengthening of
racial differentiation and complexity of the genetic structure of
populations of bees of Central race [Grankin, 1998]. Laws and
geographical variability clinal Central Russian bees studied
A.S.Mihaylov race (1930), A.S.Skorikov (1936), V.V.Aliatov (1948).
However, only the nature of the change clinal morphometric characters
can not explain the complexity of the structure of the population of
Central bee race. This lack of scrutiny of bees Urals is of interest
for further research.
Over the past two
centuries range A. m. Mellifera has declined significantly due to
hybridization with other species A. mellifera. Thanks to hybrid forms
of human activity are widespread bee, which significantly reduced the
level of adaptation of populations to the environment [Cherevko, 1995].
At present the entire range of Central bee race dominated by hybrids of
different generations. Russia probably still oblada- etrezervami to
restore ^ gene pool. m. mellifera. 1 ° F according to B.1
1.Sat-
Tarova (2000) and A.V.Petuhova (1996), on the Urals still preserved
local bee populations of Central race. The development of huge honey
resources of Russia, located in the central and northern regions of the
European part of the country is impossible without the use of the gene
pool of all races hardy bees - of Central [Grankin, 1997]. Central
Russian bees are indispensable in the northern European areas of its
range, the Urals and Siberia, where the main reserves of honey Russia
[Grankin, 1998].
Among the local
populations of the Central Russian bees are best known Bashkir, Altai
and marshy [Bilash, 1991]. Evidence on the state of the gene pool of
the Bashkir honey bee population in the last decade have not been
published [Nikolenko, 2002]. Honeybees of Central race still ost ae
tsya little known subject. In particular, it relates to bee Perm
region, whose territory is located on the northern border of the
natural habitat of the honey bee [Petukhov et al., 1996].
We analyzed 268
specimens of 134 bee families in 7 districts of the Perm region, where
the material is going to together with teacher PGPU A.V.Petuho- vym and
730 species of bees from 365 families in three districts of the
Republic of Bashkortostan (Such tyshlinsky, Ipshnsky and Burzyan).
According to estimates of the frequency of alleles identified areas
shte share allele PQQ above 0.9. In the Perm region vsche- poured two
such populations - Visherskaya, which includes apiary Krasnovishersky
district, and South Prikamskaya population, which includes apiary Orda,
Chastin- ray, Nytvensky, Perm, Osa region. In Uinskom area, in contrast
to the results A.V.Pstuhova share allele PQQ less than 0.9. In the
Republic of Bashkortostan has been allocated Tatyshlinskaya population,
which includes apiary Such tyshlinskogo area. Reconfirm Burzyan
belonging to the populations of Central race. The Hi Lynskey area share
allele PQQ less than 0.9.
Thus, in the
Urals
identified four surviving local population of Central honeybee race,
which will later be declared as genetic reserves. |
005.
Ильясов Р.А.,
Петухов А.В., Поскряков А.В., Николенко А.Г. Поиск генетических
резерватов Apis mellifera mellifera на Урале на основе полиморфизма
митохондриальной ДНК. Материалы XII молодежной научной конференции
"Актуальные проблемы биологии и экологии". Сыктывкар. 2005. C. 97-98.
По
морфометрическим исследованиям Ruttner’a (1988) вид Apis
mellifera L. подразделяется на 25 географических рас или подвидов. Их
ареалы очень малы и, в основном, расположены в зоне с теплым климатом.
Только подвид Apis mellifera mellifera занимает огромную территорию
вдоль северной границы естественного ареала в лесной и лесостепной
зонах Европы, где довольно холодный климат. Таким образом, Apis
mellifera mellifera представляет огромную ценность для пчеловодства
России, северо-вропейских и других стран, являясь уникальным подвидом,
который оптимален для разведения в зоне с холодным
умеренно-континентальным климатом. Однако, ареал Apis mellifera
mellifera постоянно сокращается из-за гибридизации с другими подвидами.
В результате икусственных миграций подвидов гибриды широко
распространились по всему ареалу и даже стали численно превосходить[2].
По данным
Саттарова
(2000) на территории Башкортостана в Бурзянском районе сохранилась
локальная популяция Apis mellifera mellifera. Морфометрические
измерения А.В. Петухова (1996) позволяют предположить, что локальные
популяции Apis mellifera mellifera сохранились в Пермской области в
Красновишерском и Уинском районах. Для сохранения и восстановления
генофонда на всем ареале необходимо иметь, как минимум, несколько
резерватов негибридизованного аборигенного генофонда, которые будут
использоваться в искусственном восстановлении. Поэтому необходимо
выяснить нынешнее состоянии обнаруженных ранее локальных популяций и
вести поиск еще неизвестных популяций Apis mellifera mellifera.
Огромная территория Урала, покрытая лесами, еще не изучена полностью, и
есть большие шансы, что существуют другие локальные популяции Apis
mellifera mellifera.
Мы применили
метод
изучения полиморфизма локуса COI-COII мтДНК [1], позволяющий быстро и
точно выявить происхождение семей пчел по материнской линии, для поиска
еще не выявленных ранее локальных популяций подвида Apis mellifera
mellifera на Урале.
Нами было
проанализировано 134 семьи в Пермской области, где выделили вишерскую и
южно-прикамская локальные популяции, где частота встречаемости аллеля
PQQ близка к 100%. Предположение А.В. Петухова (1996), о существовании
уинской локальной популяции не подтвердилось. Кроме того, мы
проанализировали 365 семей в республике Башкортостан. Была выделена
татышлинская локальная популяция, дополнительно к ранее изученной
Саттаровым (2000) бурзянской, частота встречаемости аллеля PQQ которой
также близка к 100%.
Таким образом,
обнаруженные 4 локальные популяции могут быть выделены, как
генетические резерваты Apis mellifera mellifera на Урале и
использоваться в востановлении генофонда.
By morphometric
study
Ruttner'a (1988) kind of Apis mellifera L. is divided into 25
geographical races or subspecies. They are very small and ranges, are
mainly located in the zone with a warm climate. Only the subspecies
Apis mellifera mellifera occupies a vast territory along the northern
border of natural habitat in the forest and steppe zones of Europe,
where relatively cold climate. Thus, Apis mellifera mellifera is of
great value for beekeeping Russia, north of the WHO European and other
countries, as a unique subspecies, which is optimal for breeding in the
area with a cold temperate continental climate. However, the area of
Apis mellifera mellifera is steadily declining due to hybridization
with other subspecies. As a result of migration ikusstvennyh subspecies
hybrids are widely spread throughout the entire range, and even began
to outnumber [2].
According
Sattarova
(2000) on the territory of Bashkortostan region Burzyan save a local
population of Apis mellifera mellifera. The morphometric measurements
AV Petukhov (1996) suggest that local populations Apis mellifera
mellifera preserved in the Perm region in Krasnovishersk and Uinskom
areas. To save and restore the gene pool in the whole area, you must
have at least a few reserves unhybridised aboriginal gene pool to be
used in artificial restoration. It is therefore necessary to find out
the current status of the detected earlier local populations and to
seek yet unknown populations of Apis mellifera mellifera. The vast
territory of the Urals, covered with forests, not yet fully explored,
and there is a great chance that there are other local populations of
Apis mellifera mellifera.
We have applied
the
method of studying the polymorphism locus COI-COII mtDNA [1], allowing
you to quickly and accurately identify the origin of bee families on
the maternal side, to find has not previously identified local
populations subspecies Apis mellifera mellifera in the Urals.
We have analyzed
134
families in the Perm region, where isolated Visherskaya and South
Prikamskaya local populations where the incidence of allele PQQ is
close to 100%. The assumption A. Petukhov (1996), the existence of
uinskoy local population has not been confirmed. In addition, we
analyzed 365 families in the Republic of Bashkortostan. It was
allocated tatyshlinskaya local population, in addition to the
previously studied Sattarov (2000) Burzyan, frequency of allele PQQ
which is also close to 100%.
Thus, found 4
local
populations can be isolated as genetic reserves Apis mellifera
mellifera in the Urals and used in restoring the gene pool. |
004.
lyasov R.A. Four
populations of Apis mellifera mellifera L. in Urals. Apis-UK No.38.
August 2005. (http://www.beedata.com/apis-uk/newsletters08/index.htm).
Apis
mellifera
mellifera L. is a very interesting honey bee. Its high cold endurance
and high capacity for work had made it indispensable for northern
beekeeping in the Urals. The climate of the the Urals is very
inhospitable with long winters and short summers. The bees of the Urals
are therefore special dark European bees adapted to the region.
Unfortunately, many areas were hybridizated by Apis mellifera caucasica.
In the
biochemistry and
insect adaptability laboratory we carry out research into these
autochtonous honey bees. We use different methods for the
identification of the dark european bee population. We found in the
Bashkortostan republic and the Perm oblast (Russia, South and Middle
Urals) four unique not hybridizated populations of Apis mellifera
mellifera by morphometrical, molecular methods. We investigated by PCR
analysis of the intergenic region COI-COII; microsatellite locii 4A110,
Ap243, Ap049; the locus of gene antibacterial peptide defensin; locus
of 2 subunit NADH dehydrogenase (ND2). We sent sequences of the ND2
gene to GenBank. Future plans include identification of new dark
european honey bees in other regions of Russia.
Our
investigations will
also help to restore the native gene pool of Apis mellifera mellifera
L. in the hybridizated regions. We would be glad to collaborate with
other European bee researchers and beekeepers. We think, all subspecies
of bees must live separately and must not be hybridized. We must save
unique dark European honey bee. |
003. Ilyasov R.A., Baymiev A.K., Poskryakov A.V., Nikolenko A.G. Phylogenetics researches
in Apis mellifera mellifera L. concluded from mitochondrial DNA
sequence in Urals. GenBank. 2005. accession numbers DQ181611-DQ181622
(http://www.ncbi.nlm.nih.gov).
Apis mellifera pop-variant
Burzyanskii, Borti NADH dehydrogenase subunit 2 (ND2) gene, partial
cds; mitochondrial
GenBank:
DQ181611.1
FASTA Graphics
PopSet
Go to:
LOCUS
DQ181611
615 bp
DNA linear
INV 26-SEP-2005
DEFINITION
Apis mellifera pop-variant Burzyanskii, Borti NADH dehydrogenase
subunit 2 (ND2) gene, partial cds; mitochondrial.
ACCESSION
DQ181611
VERSION
DQ181611.1 GI:75863966
KEYWORDS
.
SOURCE
mitochondrion Apis mellifera (honey bee)
ORGANISM Apis mellifera
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita;
Aculeata; Apoidea; Apidae; Apis.
REFERENCE
1 (bases 1 to 615)
AUTHORS Ilyasov,R.A., Baymiev,A.K., Poskryakov,A.V.
and Nikolenko,A.G.
TITLE Phylogenetics researches
in Apis mellifera mellifera L. concluded
from mitochondrial DNA sequence in Urals
JOURNAL Unpublished
REFERENCE
2 (bases 1 to 615)
AUTHORS Ilyasov,R.A., Baymiev,A.K., Poskryakov,A.V.
and Nikolenko,A.G.
TITLE Direct Submission
JOURNAL Submitted (29-AUG-2005) Russian Academy of
Sciences, Ufa Scientific
Center, Institute of Biochemistry and Genetics, Prospect Octyabrya,
71, Ufa 450054, Russia
FEATURES
Location/Qualifiers
source
1..615
/organism="Apis mellifera"
/organelle="mitochondrion"
/mol_type="genomic DNA"
/db_xref="taxon:7460"
/sex="worker"
/tissue_type="thorax"
/dev_stage="adult"
/pop_variant="Burzyanskii, Borti"
/country="Russia: Bashkortostan"
gene
1..>615
/gene="ND2"
CDS
1..>615
/gene="ND2"
/codon_start=1
/transl_table=5
/product="NADH dehydrogenase subunit 2"
/protein_id="ABA29194.1"
/db_xref="GI:75863967"
/translation="MFFMNFKYHWFIYLLITIFVLMMNSNNIFIQWMLMEFGTIISIS
LINIKSTNKTPSLIYYSVSVISSIFLFFMIIVYLSSISFTKTDTFNFMVQMMFFLKIG
TFPFHFWMIYSYEMMNWKQIFLMSTLIKFIPIYMMVSMTKINSWTLYFLITNSLYISF
YANKFYTLKKLLACSTIFNSFYFIFILELNKNMFIAMIILYSFNY"
ORIGIN
1 attttcttca taaattttaa ataccactga tttatttatc ttttaattac tatttttgta
61 ttaataataa attccaataa tatttttatt caatgaatat taatagaatt tggtacaatc
121 attagaatta gattaattaa tattaaatcc acaaataaaa ccccaagatt aatttattat
181 tcagtatcag taatttcaag aattttttta ttctttataa ttattgtata cttatcatcc
241 attagattta ctaaaacaga tacttttaat tttatagttc aaataatatt ttttttaaaa
301 attggaactt tcccttttca tttttgaata atttattctt atgaaataat aaattgaaag
361 caaatttttt taatatcaac attaattaaa tttattccaa tttatataat agtttcaata
421 actaaaatta attcatgaac attatatttt ttaattacaa atagattata tatttcattt
481 tatgcaaata aattttatac tctaaaaaaa ttattagcat gctcaacaat ttttaattca
541 ttctatttta tttttatttt agaattaaac aaaaatatat ttattgctat aattatttta
601 tattcattta attat
// |
002. Ильясов Р.А., Николенко А.Г., Пономарев В.А., Ащеулов В. И. RAPD-PCR полиморфизм популяций шмеля Bombus terrestris (L.). Материалы 55-ой международной научно-практической конференции "Актуальные проблемы науки в агропромышленном комплексе". Кострома. 2004. Т. 2. С. 99-100.
С развитием шмелеводства возрастает актуальность научных исследований в этой области, в том числе популяционно-генетических исследований. Целью данной рабогы был сравнительный анализ RAPD полиморфизма шмелей ряда популяций Bombus terrestris.
ДНК шмелей выделялась из грудных мышц методом экстракции в системе фенол- хлороформ с добавлением саркозила. Для проведения RAPD-PCR использовались праймеры 949 (5’-GTTGGCCGACGTATА-3 ’) и 950 (5’-GACCTCAGCACGACC-3’). Программа для амплификации (35 циклов): (92° - 40 с) - (48° - 60 с) - (72° - 80 с).
Было выявлено 12 полос RAPD фрагментов, где полиморфными являлись 9 полос, а мономорфными 3 полосы. На основании полиморфных фрагментов RAPD-спектров была построена матрица ’’объект-признак” и определены частоты встречаемости фрагментов в исследованных выборках (табл. I).
Фрагменты, соответствующие 95% критерию полиморфнасти, были использованы для расчета генетических расстояний между популяциями шмелей по формуле М.Нея fNei. 1975).
Кластерный анализ, основанный на рассчитанных нами генетических расстояниях, показал высокую степень близости между выборками из краснодарской и голландской популяций. Очень близко к ним расположена израильская популяция. Все три выборки могут быть продуктом искусственного разведения, полученным практически из одного источника (или из 2-3 близкородственных). Природные выборки из нижненовгородской и воронежской популяций существенно отличались от остальных. Как следствие, это, во-первых, подтверждает наличие генетически отличающихся популяций в данных регионах, во-вторых, эти популяции могуч служить ценным источником генетического материала для внутривидового скрещивания.
На основе базовой матрицы были рассчитаны коэффициенты биоразнообразия для исследуемых популяций (табл. 3). Однако однозначные комментарии к таблице сделать трудно из-за разного объема выборок, что могло отразиться на ветчине коэффициента.
Уровень биоразнообразия - показатель стабильности популяции. Представления об оптимальной гетерозиготности как мере максимума адаптации популяции к конкретной среде, в которой они сформировались и обитают ныне, сформулированы Ю.ПАптуховым (Алтухов, 1972). Высокая гетерозшотность, будучи выгодной для отдельной особи, может оказался нежелательной для приспособленности популяции в целом, так как количество выще- пляемых !енотинов оказывается неадаптивным.
Таким образом, в дальнейшем полученные нами значения популяционного биоразнообразия шмелей можно сравнивать с будущими данными и на основе этою сравнения делать выводы о ходе развития популяции, характере изменения ее гетерогенности, оптимизировать ход развития популяций. При искусственном вое произволе гве популяций важно помнить, что каждая из них имеет свой эволюцпонно сложившийся биологический оптимум биоразнообразия, определяемый предшествующей эволюцией и современным положением популяции в экосистеме. Границы такого оптимума задаются её минимальным и максимальным уровнями, устойчивые опенки которых могут быть получены через усреднение результатов нескольких наблюдений. Без знания параметров зоны нуклеотидной сбалансированности генофондов, их успешное сохранение и воспроизводство крайне затруднительно.
With the development of shmelevodstva increases the relevance of research in this area, including population genetic studies. The purpose of this comparative analysis was rabogy RAPD polymorphism number of populations of bumblebees Bombus terrestris.
DNA was extracted from bumblebees pectoral muscles by extraction in the phenol-chloroform with the addition of Sarkozy. For carrying RAPD-PCR primers 949 (5'-GTTGGCCGACGTATA-3 ') and 950 (5'-GACCTCAGCACGACC-3'). The program for amplification (35 cycles): (92 ° - 40) - (48 ° - 60) - (72 ° - 80).
It was revealed 12 bands RAPD fragments, where polymorphic bands were 9 and 3 monomorphic strip. On the basis of polymorphic fragments RAPD-spectra matrix was built '' object-sign "and the frequencies of occurrence of fragments in the studied samples (Table. I).
The fragments corresponding to the 95% criterion polimorfnasti, were used to calculate genetic distances between populations of bumblebees formula M.Neya fNei. 1975).
Cluster analysis based on genetic distances calculated by us, showed a high degree of similarity between the samples from the Krasnodar and Dutch populations. Very close to it is the Israeli population. All three samples may be a product of artificial breeding obtained practically from one source (or closely related 2-3). Natural selection from nizhnenovgorodskoy and Voronezh populations differed significantly from the others. As a consequence, it is, first, confirms the presence of genetically diverse populations in these regions, and secondly, E1I population mighty serve as a valuable source of genetic material for intraspecific crosses.
Based on matrix of coefficients were calculated for the study of biodiversity of populations (Table. 3). However, unambiguous comments to the table to make difficult because of the different sample sizes that could affect the ham factor.
The level of biodiversity - an indicator of the stability of the population. Submissions on best heterozygosity as a measure of the maximum adaptation of the population to the specific environment in which they were formed and now live formulated Yu.PAptuhovym (Altukhov, 1972). High geterozshotnost being profitable for a private individual, it may not be desirable to accommodate the population in general, as the number of leached plyaemyh! Enotinov is maladaptive.
Thus, in the future our values ass.] [Yatsionnogo biodiversity bumblebees can be compared with future data, and based on the comparison etoyu draw conclusions about the development of the population, changes in the nature of its heterogeneity, optimize course of populations. With artificial howling outrage gve populations is important to remember that each of them has its evolyutsponno prevailing biological optimum biodiversity, defined the evolution of the previous and current status of populations in an ecosystem. The boundaries of the optimum set its minimum and maximum levels of resistant Estimates which can be obtained by averaging the results of several observations. Without knowing the parameters of the zone balance nucleotide gene pools, their successful conservation and reproduction is extremely difficult. |
001. Ильясов Р.А., Николенко А.Г. Полиморфизм локуса COI-COII митохондриальной ДНК пчелы Пермской области. Материалы III съезда всероссийского общества генетиков и селекционеров "Генетика в XXI веке: современное состояние и перспективы развития". Москва. 2004. Т.1. С. 202.
Северная прикамская популяция медоносной пчелы среднерусской расы Apis mellifera mellifera на данный момент малоизучена (Петухов и др, 1996). Она занимает территорию бассейна реки Камы между 56-62 с.ш. и 52-59 в.д. Это северная граница естественного ареала медоносной пчелы, которая простирается от хвойно-широколиственной подзоны на юге до северной среднетаежной подзоны на севере. По данным А.В. Петухова и др. (1996), пчелы Пермской области принадлежат среднерусской расе. А.В. Петухов выделил две четко различающиеся группы прикамских пчел из двух разных подзон тайги: уинская группа – на юге и вишерская группа – на севере (Петухов и др, 1996).
Целью нашего исследования является изучение структуры популяции медоносной пчелы прикамской популяции, определение полиморфизма локуса COI-COII митохондриального ДНК, что является маркером расовой принадлежности пчел (Николенко и др., 2002) и сравнение полученных данных с морфометрическими данными.
Для исследования был собран материал из семи районов Пермской области:
Красновишерского р-на – 2 пасеки (32 улья), Нытвенского р-на – 1 пасека (9 ульев), Пермского р-на - 1 пасека (23 улья), Осинского р-на - 1 пасека (9 ульев), Частинского р-на - 1 пасека (5 ульев), Ординского р-на - 2 пасеки (20 ульев), Уинского р-на – 3 пасеки (36 ульев).
Пчеловодные хозяйства Нытвенского, Частинского, Уинского, Красновишерского, Кунгурского районов являются племенными и разводят пчел среднерусской расы (Петухов и др, 1996; Бояршинов и др., 2001). Однако результаты анализа локуса COI-COII митохондриального ДНК показали присутствие в выборке популяции Уинского района около 30% гибридизированных семей. Молекулярно-генетические методы позволяют выявить помесные семьи, которые могут остаться незамеченными при использовании только морфометрического метода, поэтому необходимо совместное использование обоих методов.
Результаты нашего исследования подтвердили выявленную ранее относительную однородность прикамской популяции медоносной пчелы. По результатам изучения пасек двух групп прикамской популяции медоносной пчелы, в вишерской группе 100%, а в уинской – только 70% пчел среднерусской расы Apis mellifera mellifera.
North Prikamskaya population of Central honeybee Apis mellifera mellifera race at the moment little studied (Petukhov et al, 1996). It covers an area between the Kama River Basin 56-62 N and 52-59 E It is the northern boundary of the natural range of the honey bee, which stretches from the coniferous-deciduous subzone in the south to the northern middle taiga subzone in the north. According to AV Petukhov et al. (1996), bees belong to the Perm region of Central race. AV Petukhov identified two distinct groups of Kama bees from two different subzones taiga uinskaya group - in the south and Visherskaya group - in the north (Petukhov et al, 1996).
The aim of our study is to investigate the population structure of the honeybee population in Kama region, the definition of polymorphism locus COI-COII mitochondrial DNA, which is a marker of racial bees (Nikolenko et al., 2002) and comparing the data obtained with morphometric data.
To study the material was collected from seven districts of the Perm region:
Krasnovishersky district - 2 apiary (beehive 32) Nytvensky district - 1 apiary (beehives 9), Perm district - 1 apiary (beehive 23) Osa district - 1 apiary (beehives 9), p Chastinskogo -on - 1 apiary (5 hives), Orda district - 2 apiary (20 hives) Uinskogo district - 3 apiary (36 hives).
Beekeeping economy Nytvensky, Chastinskogo, Uinskogo, Krasnovishersky, Kungurskoe areas are tribal and Central Russian breed of bees race (Petukhov et al, 1996; Boyarshinov et al., 2001). However, an analysis of locus COI-COII mitochondrial DNA showed the presence in the sample population Uinskogo area about 30% hybridized families. Molecular genetic methods allow to identify the hybrid family that can go unnoticed when only morphometric method, so you need to share both.
The results of our study confirmed the previously identified the relative homogeneity of the Kama region honeybee populations. As a result of the study of two groups of apiaries in Kama region of honeybee populations in Visherskaya group 100% and uinskoy - Only 70% of Central bee race Apis mellifera mellifera. |
